DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 18w and RLP7

Sequence 1:NP_476814.1 Gene:18w FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_175225.1 Gene:RLP7 AraportID:AT1G47890 Length:1019 Species:Arabidopsis thaliana

Alignment Length:773 Identity:181/774 (23%)
Similarity:292/774 (38%) Gaps:202/774 (26%)


  Fly    35 GLTTMDIRCSVRALESGTG-TPLDLQVAEAAGRLDLQCS----QELLH----ASELAPGLFRQLQ 90
            ||..:|:..|     |.:| .|::|........|||..|    .|..|    .....|.|.|.|:
plant   168 GLERLDLSQS-----SLSGQIPINLLQLTKLVSLDLSSSDFFGDESFHYLSIDKSFLPLLARNLR 227

  Fly    91 KLSELRIDACKLQRVPPNAFEGLMSLKRLTLESHNAVWGPGKTLELHGQ---SFQGLKELSELHL 152
            .|.||.:...|:....|..|..:.||:.|.|...|          |.|:   |...:..|..:.|
plant   228 NLRELDMSYVKISSEIPEEFSNIRSLRSLNLNGCN----------LFGEFPSSILLIPNLQSIDL 282

  Fly   153 GDN-NIR-QLPEGVWCSMPSL-------------------QLLNLTQNRIRSAEFLG---FS--- 190
            |:| |:| .||  |:....||                   .|.|||...:..:.|.|   ||   
plant   283 GNNPNLRGNLP--VFHENNSLLKLTILYTSFSGAIPDSISSLKNLTSLTLSVSYFSGKIPFSLGN 345

  Fly   191 ------EKLCAGSALSNANGAVSGGSELQTLDVSFNELR-SLPDAWGASRLRRLQTLSLQHNNIS 248
                  ..|.:.:.:.....::...::|....|..|:|. :||..  .|.|.:|.|:||..|..:
plant   346 LSHLSHLSLSSNNLIGEIPSSIGNLNQLTNFYVGGNKLSGNLPAT--LSNLTKLNTISLSSNQFT 408

  Fly   249 TLAPNALAGLSSLR--------VLNISYNHLVSLPSEAFAGNKELRELHLQGNDLYELPKG---- 301
            ...|.:::.||.|:        .:....:.|:.:||        |..:||..|.|.:| .|    
plant   409 GSLPPSISQLSKLKFFFADDNPFIGAILSPLLKIPS--------LTRIHLSYNQLNDL-VGIENI 464

  Fly   302 -LLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNAL--TRIGSKTFKELYF----- 358
             :|..||...:...  |......:|.:.|:.|.:|..|.:|...:  |.|.|.....|.:     
plant   465 FMLPNLETFYIYHY--NYTKVRPLDLNVFSSLKQLGTLYISRIPISTTNITSDFPSNLEYLSLRS 527

  Fly   359 ---------------LQILDMRNNSI-GHIEEGAFLPLYNLHTLNLAENRLHTLDNRIFNGLYVL 407
                           |||||:.||.| |.:.:.    |:.:.|||..:     |.|...:|.:|.
plant   528 CNITDFPEFIRKGRNLQILDLSNNKIKGQVPDW----LWRMPTLNSVD-----LSNNSLSGFHVS 583

  Fly   408 TKLTLNNNLVSI-VESQAFRN-----CSDLKELDLSSNQLT-EVPEAVQDLSMLKTLDLGENQIS 465
            .|.:..:.|.|: :.|.||:.     ...|:....|:|..| ::|.::..||.|:.|||..|.::
plant   584 VKASPESQLTSVDLSSNAFQGPLFLPSKSLRYFSGSNNNFTGKIPRSICGLSSLEILDLSNNNLN 648

  Fly   466 -----------------EFKNNT--------FRNLNQLTGLRLIDNRIGNITVGMFQDLPRLSVL 505
                             :.:||:        |.|..:|..|.:..||:.....|.......|.||
plant   649 GSLPWCLETLMSSLSDLDLRNNSLSGSLPEIFMNATKLRSLDVSHNRMEGKLPGSLTGCSSLEVL 713

  Fly   506 NLAKNRIQSIERGAFDKNTEIEAIRLDKN----FLTDINGIFATLASLLWLNLSENHLVWFDYAF 566
            |:..|||..:.....:...:::.:.|..|    .|.:::|::.....|..:::|.|..    :..
plant   714 NVGSNRINDMFPFELNSLQKLQVLVLHSNKFHGTLHNVDGVWFGFPQLQIIDVSHNDF----FGI 774

  Fly   567 IPSN--LKWL--------DIHGNYIE-------ALGNYYKL--------QEEIRV----TTLDAS 602
            :||:  :.|.        :|...||:       :||.|..|        .|..||    |.:|.|
plant   775 LPSDYFMNWTAMSSKKDNNIEPEYIQNPSVYGSSLGYYTSLVLMSKGVSMEMERVLTIYTAIDLS 839

  Fly   603 HNRITEIGAMSVPNSI----ELLFIN---NNIIGQIQANTFVDKTRLARVDLYANVLS 653
            .|::..    .:|:||    ||..:|   |...|.| .::..:...|..:|:..|.:|
plant   840 GNQLHG----KIPDSIGLLKELRILNMSSNGFTGHI-PSSLANLKNLESLDISQNNIS 892

Known Domains:


GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380 10/33 (30%)
leucine-rich repeat 92..115 CDD:275380 6/23 (26%)
LRR_8 115..181 CDD:290566 23/90 (26%)
leucine-rich repeat 116..146 CDD:275380 7/33 (21%)
leucine-rich repeat 147..170 CDD:275380 9/25 (36%)
leucine-rich repeat 171..201 CDD:275380 10/61 (16%)
LRR_RI 210..464 CDD:238064 76/298 (26%)
leucine-rich repeat 212..236 CDD:275380 8/25 (32%)
LRR_8 235..295 CDD:290566 16/68 (24%)
leucine-rich repeat 237..260 CDD:275380 8/23 (35%)
leucine-rich repeat 261..284 CDD:275380 4/31 (13%)
LRR_8 283..345 CDD:290566 17/67 (25%)
leucine-rich repeat 285..308 CDD:275380 10/28 (36%)
leucine-rich repeat 309..334 CDD:275380 4/25 (16%)
LRR_8 334..393 CDD:290566 20/82 (24%)
leucine-rich repeat 335..358 CDD:275380 7/25 (28%)
leucine-rich repeat 359..382 CDD:275380 10/24 (42%)
LRR_8 382..441 CDD:290566 16/65 (25%)
leucine-rich repeat 383..406 CDD:275380 6/23 (26%)
leucine-rich repeat 407..430 CDD:275380 6/29 (21%)
LRR_8 431..488 CDD:290566 20/83 (24%)
leucine-rich repeat 431..451 CDD:275380 5/21 (24%)
leucine-rich repeat 454..477 CDD:275380 9/48 (19%)
LRR_8 477..559 CDD:290566 19/86 (22%)
leucine-rich repeat 478..499 CDD:275380 5/21 (24%)
leucine-rich repeat 502..525 CDD:275380 7/23 (30%)
leucine-rich repeat 526..548 CDD:275380 4/26 (15%)
leucine-rich repeat 590..617 CDD:275380 9/39 (23%)
leucine-rich repeat 618..641 CDD:275380 7/30 (23%)
leucine-rich repeat 642..689 CDD:275380 4/13 (31%)
LRRCT 679..736 CDD:214507
leucine-rich repeat 775..796 CDD:275380
LRR_8 797..852 CDD:290566
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
LRR_8 841..900 CDD:290566
leucine-rich repeat 842..865 CDD:275380
LRR_4 866..907 CDD:289563
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
RLP7NP_175225.1 LRRNT_2 75..112 CDD:285463
LRR_RI <163..>285 CDD:238064 35/132 (27%)
leucine-rich repeat 169..192 CDD:275380 7/28 (25%)
leucine-rich repeat 193..228 CDD:275380 10/35 (29%)
leucine-rich repeat 229..252 CDD:275380 6/23 (26%)
leucine-rich repeat 253..276 CDD:275380 7/33 (21%)
leucine-rich repeat 277..324 CDD:275380 12/49 (24%)
leucine-rich repeat 325..396 CDD:275380 15/73 (21%)
LRR_RI <387..602 CDD:238064 59/237 (25%)
leucine-rich repeat 397..420 CDD:275380 8/23 (35%)
leucine-rich repeat 421..444 CDD:275380 3/23 (13%)
leucine-rich repeat 445..469 CDD:275380 8/25 (32%)
LRR_8 518..577 CDD:290566 16/68 (24%)
leucine-rich repeat 520..542 CDD:275380 1/22 (5%)
leucine-rich repeat 543..566 CDD:275380 10/27 (37%)
LRR_RI 567..>744 CDD:238064 42/182 (23%)
leucine-rich repeat 567..612 CDD:275380 12/50 (24%)
LRR_8 590..647 CDD:290566 17/57 (30%)
leucine-rich repeat 613..636 CDD:275380 7/23 (30%)
leucine-rich repeat 637..661 CDD:275380 5/24 (21%)
LRR_8 660..720 CDD:290566 15/60 (25%)
leucine-rich repeat 662..685 CDD:275380 4/23 (17%)
leucine-rich repeat 686..709 CDD:275380 5/23 (22%)
LRR_8 708..771 CDD:290566 14/63 (22%)
leucine-rich repeat 710..733 CDD:275380 7/23 (30%)
leucine-rich repeat 734..760 CDD:275380 4/26 (15%)
leucine-rich repeat 815..856 CDD:275380 11/45 (24%)
LRR_8 855..915 CDD:290566 10/40 (25%)
leucine-rich repeat 857..880 CDD:275380 5/24 (21%)
leucine-rich repeat 881..904 CDD:275380 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1871
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.