DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 18w and RLP6

Sequence 1:NP_476814.1 Gene:18w FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_175139.1 Gene:RLP6 AraportID:AT1G45616 Length:994 Species:Arabidopsis thaliana

Alignment Length:1078 Identity:235/1079 (22%)
Similarity:374/1079 (35%) Gaps:346/1079 (32%)


  Fly    30 CNWQYGLTTMDIRCSVRALESGTGTPLDLQVAEAAGRLDLQCSQELLHASELAPGLFRQLQKLSE 94
            |.|. |:|     |..:   ||..|.|||..:...|||:...|            ||| ||.|..
plant    85 CYWD-GIT-----CDTK---SGKVTGLDLSCSCLHGRLEPNSS------------LFR-LQHLQS 127

  Fly    95 LRIDACKLQRVP-PNAFEGLMSLKRLTLESHNAVWGPGKTLELHGQSFQGLKELSELHLGDNNIR 158
            :.:........| |..|...|.|:||.|..               .||.|       |:      
plant   128 VNLAYNNFTNSPIPAEFSKFMRLERLNLSR---------------SSFSG-------HI------ 164

  Fly   159 QLPEGVWCSMPSLQLLNLTQNRIRSAEFLGFSEKLCAGSALSNANGAVSGGSELQTLDVSFNELR 223
                    |:..|||.||.            |..|.:....|.::.::.....|..|.::|..||
plant   165 --------SIKLLQLTNLV------------SLDLSSSFPYSPSSLSIEKPLFLHLLALNFMNLR 209

  Fly   224 SLPDA---------------W--------GASRLRR----------LQTLSLQHN-NISTLAPNA 254
            .|..:               |        |.:.|.|          |:::||.|| |:....||.
plant   210 ELDMSSVDISSAIPIEFSYMWSLRSLTLKGCNLLGRFPNSVLLIPNLESISLDHNLNLEGSLPNF 274

  Fly   255 LA--GLSSLRVLNISYN-----------HLVS--LPSEAFAGN--KELREL-HL------QGNDL 295
            |.  .|..|.:.|.|::           ||.|  |...||:|.  ..||.| ||      :.|.:
plant   275 LRNNSLLKLSIYNTSFSGTIPNSISNLKHLTSLKLQQSAFSGRIPSSLRSLSHLSNLVLSENNFV 339

  Fly   296 YELPKGLLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSKTFKELYFLQ 360
            .|:|.. :..|:||.:.|:|.|.|..:.  .|:...|.:|..:::.:|..|.....|..:|..|:
plant   340 GEIPSS-VSNLKQLTLFDVSDNNLNGNF--PSSLLNLNQLRYIDICSNHFTGFLPPTISQLSNLE 401

  Fly   361 ILDMRNNSI-GHIEEGAFLPLYNLHTLNLAENRLHTLDN-RIFNGLYVLTKLTLNNN--LVSIVE 421
            .....:||. |.|....| .:.:|.||.|:.|:|:...| :..:.|:.|.:|.|:||  ..|.|:
plant   402 FFSACDNSFTGSIPSSLF-NISSLTTLGLSYNQLNDTTNIKNISLLHNLQRLLLDNNNFKASQVD 465

  Fly   422 SQAFRNCSDLKELDLSSNQL--TEVPEAVQDLSMLKTLDLGENQISEFKNNTFRNLNQLTGLRLI 484
            ...|.:...|..|.||...|  |.:....:..|.|:.|:|....|.||. ...||...|:.:.|.
plant   466 LDVFLSLKRLVSLALSGIPLSTTNITSDSEFSSHLEYLELSGCNIIEFP-EFIRNQRNLSSIDLS 529

  Fly   485 DNRIGNITVGMFQDLPRLSVLNLAKNRIQSIERGAFDKNTEIEAIRLD----------------- 532
            :|.|..........||.||.::|:.|.:... .|:....:..:.:.||                 
plant   530 NNNIKGQVPNWLWRLPELSTVDLSNNSLIGF-NGSLKALSGSKIVMLDLSSNAFQGPLFMPPRGI 593

  Fly   533 -------KNFLTDINGIFATLASLLWLNLSENHLVWFDYAFIP-------SNLKWLDIHGNYIE- 582
                   .||...|......||:.|.|:||.|:|    :..||       |:|..|::..|.:: 
plant   594 QYFLGSYNNFTGYIPPSICGLANPLILDLSNNNL----HGLIPRCLEAQMSSLSVLNLRNNSLDG 654

  Fly   583 ALGNYYKLQEEIRVTTLDASHNRITEIGAMSVP----NSIELLFINNNIIGQIQANTFVDKTRLA 643
            :|.|.: :..:: :::||.|||.:.  |.:...    :::|:|.:.:|.|.    :||       
plant   655 SLPNIF-MNAKV-LSSLDVSHNTLE--GKLPASLAGCSALEILNVESNNIN----DTF------- 704

  Fly   644 RVDLYANVLSKISLNALRVAPVSAEKPVPEFYLGGNPFECDCSMEWLQRINNLTTRQHPHVVDLG 708
              ..:.|.|.|:.:..|                               |.||.....|       
plant   705 --PFWLNSLPKLQVLVL-------------------------------RSNNFRGTLH------- 729

  Fly   709 NIECLMPHSRSAPLRPLASLSASDFVCKYESHCPPTCHCCEYEQCECEVICPGNCSCFHDATWAT 773
            |::.:.   ...||..:..:|.:|||                          |.....:...|..
plant   730 NVDGVW---FGFPLLRITDVSHNDFV--------------------------GTLPSDYFMNWTA 765

  Fly   774 NIVDCGRQDLAALPNRIPQDVSDLYLDGNNMPELEVGHLTGRRNLRALYLNASNLMTLQNGSLAQ 838
                            |.:..::|...|:  || :.|:.|.     .:.:|....|.:|.    .
plant   766 ----------------ISKSETELQYIGD--PE-DYGYYTS-----LVLMNKGVSMEMQR----I 802

  Fly   839 LVNLRVLHLENNKLTALEGTEFRSLGLLRELY---LHNNMLTHISNATFEPLVSLEVLRLDNNRL 900
            |....|:....||   ::|....|:|:|:||:   |.:|..|....::...|.:||.|.:..|::
plant   803 LTKYTVIDFAGNK---IQGKIPESVGILKELHVLNLSSNAFTGHIPSSLANLTNLESLDISQNKI 864

  Fly   901 SS--LPHLQYRHSLQGLTLGRNAWSCRCQQLRELAQFVSDNAMVVRDAHDIYCLDAGIKRELELI 963
            ..  .|.|....||:.:.:..|                                        :|:
plant   865 GGEIPPELGTLSSLEWINVSHN----------------------------------------QLV 889

  Fly   964 GNLANG-----PDCSDLLDASASNISSSQDLAGGYRLP 996
            |::..|     .:||..........||.:|:.|....|
plant   890 GSIPQGTQFHRQNCSSYEGNPGIYGSSLKDVCGDIHAP 927

Known Domains:


GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380 8/25 (32%)
leucine-rich repeat 92..115 CDD:275380 5/24 (21%)
LRR_8 115..181 CDD:290566 14/66 (21%)
leucine-rich repeat 116..146 CDD:275380 7/30 (23%)
leucine-rich repeat 147..170 CDD:275380 2/23 (9%)
leucine-rich repeat 171..201 CDD:275380 8/30 (27%)
LRR_RI 210..464 CDD:238064 84/318 (26%)
leucine-rich repeat 212..236 CDD:275380 9/47 (19%)
LRR_8 235..295 CDD:290566 27/95 (28%)
leucine-rich repeat 237..260 CDD:275380 10/26 (38%)
leucine-rich repeat 261..284 CDD:275380 10/38 (26%)
LRR_8 283..345 CDD:290566 19/69 (28%)
leucine-rich repeat 285..308 CDD:275380 9/30 (30%)
leucine-rich repeat 309..334 CDD:275380 7/25 (28%)
LRR_8 334..393 CDD:290566 16/60 (27%)
leucine-rich repeat 335..358 CDD:275380 5/23 (22%)
leucine-rich repeat 359..382 CDD:275380 6/24 (25%)
LRR_8 382..441 CDD:290566 20/62 (32%)
leucine-rich repeat 383..406 CDD:275380 8/24 (33%)
leucine-rich repeat 407..430 CDD:275380 8/25 (32%)
LRR_8 431..488 CDD:290566 18/59 (31%)
leucine-rich repeat 431..451 CDD:275380 6/22 (27%)
leucine-rich repeat 454..477 CDD:275380 8/23 (35%)
LRR_8 477..559 CDD:290566 23/106 (22%)
leucine-rich repeat 478..499 CDD:275380 4/21 (19%)
leucine-rich repeat 502..525 CDD:275380 5/23 (22%)
leucine-rich repeat 526..548 CDD:275380 7/46 (15%)
leucine-rich repeat 590..617 CDD:275380 6/31 (19%)
leucine-rich repeat 618..641 CDD:275380 6/23 (26%)
leucine-rich repeat 642..689 CDD:275380 4/47 (9%)
LRRCT 679..736 CDD:214507 11/57 (19%)
leucine-rich repeat 775..796 CDD:275380 1/21 (5%)
LRR_8 797..852 CDD:290566 13/55 (24%)
leucine-rich repeat 797..817 CDD:275380 6/20 (30%)
leucine-rich repeat 818..841 CDD:275380 4/23 (17%)
LRR_8 841..900 CDD:290566 17/62 (27%)
leucine-rich repeat 842..865 CDD:275380 6/23 (26%)
LRR_4 866..907 CDD:289563 13/46 (28%)
leucine-rich repeat 866..889 CDD:275380 7/26 (27%)
leucine-rich repeat 890..911 CDD:275380 6/23 (26%)
TIR 1045..1183 CDD:214587
RLP6NP_175139.1 LRRNT_2 37..93 CDD:311940 5/14 (36%)
PLN00113 <81..>174 CDD:331614 38/147 (26%)
leucine-rich repeat 125..149 CDD:275380 5/24 (21%)
leucine-rich repeat 150..200 CDD:275380 18/98 (18%)
leucine-rich repeat 208..231 CDD:275380 4/23 (17%)
leucine-rich repeat 232..255 CDD:275380 3/23 (13%)
PLN00113 234..>915 CDD:331614 181/846 (21%)
leucine-rich repeat 256..279 CDD:275380 9/23 (39%)
leucine-rich repeat 280..303 CDD:275380 4/23 (17%)
leucine-rich repeat 304..351 CDD:275380 15/48 (31%)
leucine-rich repeat 352..375 CDD:275380 7/25 (28%)
leucine-rich repeat 376..399 CDD:275380 5/23 (22%)
leucine-rich repeat 400..423 CDD:275380 6/24 (25%)
leucine-rich repeat 475..487 CDD:275378 5/12 (42%)
leucine-rich repeat 500..522 CDD:275380 8/23 (35%)
leucine-rich repeat 523..546 CDD:275380 6/23 (26%)
leucine-rich repeat 547..571 CDD:275380 5/25 (20%)
leucine-rich repeat 572..592 CDD:275380 2/20 (10%)
leucine-rich repeat 593..616 CDD:275380 5/23 (22%)
leucine-rich repeat 617..641 CDD:275380 9/28 (32%)
leucine-rich repeat 642..665 CDD:275380 5/24 (21%)
leucine-rich repeat 666..689 CDD:275380 6/25 (24%)
leucine-rich repeat 690..713 CDD:275380 8/36 (22%)
leucine-rich repeat 741..805 CDD:275380 17/118 (14%)
leucine-rich repeat 806..829 CDD:275380 7/26 (27%)
leucine-rich repeat 830..853 CDD:275380 5/23 (22%)
leucine-rich repeat 854..877 CDD:275380 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1871
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.