DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 18w and RLP56

Sequence 1:NP_476814.1 Gene:18w FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_001330457.1 Gene:RLP56 AraportID:AT5G49290 Length:947 Species:Arabidopsis thaliana

Alignment Length:1112 Identity:250/1113 (22%)
Similarity:406/1113 (36%) Gaps:387/1113 (35%)


  Fly    93 SELRIDACKLQRVPPN----AFEGL---------MSLKRLT-LESHNAVWGPGKTLELHGQSFQG 143
            ::.:.|.|:.:.:..|    ...||         :||..|: |.....|    ::|:|......|
plant    60 NDTKSDCCQWENIKCNRTSRRLTGLSLYTSYYLEISLLNLSLLHPFEEV----RSLDLSNSRLNG 120

  Fly   144 LKELSELHLGDNNIRQLPEGVWCSMPSLQLLNLTQNRIRSA--EFLGFSEKLCAGS-ALSNANGA 205
            |.:..|   |..::|:|        .:||:||.:.|...::  .||..:..|...| ..:|..|.
plant   121 LVDDVE---GYKSLRRL--------RNLQILNFSSNEFNNSIFPFLNAATSLTTLSLRRNNMYGP 174

  Fly   206 V-----SGGSELQTLDVSFNEL------RSLPDAWGASRLRRLQTLSLQHNNI-STLAPNALAGL 258
            :     ...:.|:.||:|.|.:      |..|      .|::|:.|.|..|.| |::....|..|
plant   175 IPLKELKNLTNLELLDLSGNRIDGSMPVREFP------YLKKLKALDLSSNGIYSSMEWQGLKNL 233

  Fly   259 SSLRVLNISYNHLVS-LPSEAFAGNKELRELHLQG-NDLYELPKGLLHRLEQLLVLDLSGNQLTS 321
            ::|.||::.||:... :|.|.|...|.|:||.|:| |.:.:||. ....|.:|..||||.||||.
plant   234 TNLEVLSLGYNYFDGPIPIEVFCEMKNLQELDLRGINFVGQLPL-CFGNLNKLRFLDLSSNQLTG 297

  Fly   322 HHVDNSTFAGLIRLIVLNLSNNA------------LTRI-----GSK----------TFKELYFL 359
            :  ...:|:.|..|..|:||:|:            ||::     .||          |::.|:.|
plant   298 N--IPPSFSSLESLEYLSLSDNSFEGFFSLNPLTNLTKLKVFIFSSKDDMVQVKIESTWQPLFQL 360

  Fly   360 QILDMRNNSIGHIEEGAFLPLY--NLHTLNLAENRLHTLDNRIFNGLYVLTKLTLNNNLVSIVES 422
            .:|.:|..|:..|..  || :|  |||.::|:.||:.                       .|:.:
plant   361 SVLVLRLCSLEKIPN--FL-MYQKNLHVVDLSGNRIS-----------------------GIIPT 399

  Fly   423 QAFRNCSDLKELDLSSNQLT--EVPEAVQDLSMLKTLDLGENQISEF-----------------K 468
            ....|..:|:.|.|.:|..|  ::|.:|.:   |:.||..||.|...                 .
plant   400 WLLENNPELEVLQLKNNSFTIFQMPTSVHN---LQVLDFSENNIGGLFPDNFGRVLPNLVHMNGS 461

  Fly   469 NNTFR-----NLNQLTGLRLIDNRIGNITVGMFQDLPR--------LSVLNLAKNRIQSIERGAF 520
            ||.|:     ::.::..:..:|....|::    .:||:        ||:|.|:.|:..    |.|
plant   462 NNGFQGNFPSSMGEMYNISFLDLSYNNLS----GELPQSFVSSCFSLSILQLSHNKFS----GHF 518

  Fly   521 ----DKNTEIEAIRLDKNFLTDINGI-FATLASLLWLNLSENH--------LVWFDYAFIPSNLK 572
                ...|.:..:|::.|..|...|: ..||..|..|::|.|.        |:.|:|      |.
plant   519 LPRQTNFTSLIVLRINNNLFTGKIGVGLLTLVDLCILDMSNNFLEGELPPLLLVFEY------LN 577

  Fly   573 WLDIHGNYIEALGNYYKLQEEIRVTTLDASHNRITEIGAMSVPNSIEL---LFI-NNNIIGQIQA 633
            :||:.||.:.                           ||:  |:.:.|   ||: |||..|    
plant   578 FLDLSGNLLS---------------------------GAL--PSHVSLDNVLFLHNNNFTG---- 609

  Fly   634 NTFVDKTRLARVDLYANVLSKISLNALRVAPVSAEKPVPEFYLGGNPFECDCSMEWLQRINNLTT 698
                                                |:|:.:||        |::.|...||..:
plant   610 ------------------------------------PIPDTFLG--------SIQILDLRNNKLS 630

  Fly   699 RQHPHVVDLGNIECLMPHSRSAPLRPLASLSASDFVCKYESHCPPTCHCCEYEQCECEVICPGNC 763
            ...|..||..:|..|:....|                 ...:.|.|  .||:.:.....:.....
plant   631 GNIPQFVDTQDISFLLLRGNS-----------------LTGYIPST--LCEFSKMRLLDLSDNKL 676

  Fly   764 -----SCFHDATWATNIVDCGRQDLAALPNRIPQDVSDLY-----------------------LD 800
                 |||::.::.          ||.     .:::::.|                       ||
plant   677 NGFIPSCFNNLSFG----------LAR-----KEEITNYYVAVALESFYLGFYKSTFVVENFRLD 726

  Fly   801 GNNMPELEVGHLTGRRNLRALYLNASNLMTLQNGSLAQLVNLRVLHLENNKLTALEGTEFRSLGL 865
            .:|..|::|...|.:|     |.:.........|:|..:..   |.|.:|:|:.:...|...|..
plant   727 YSNYFEIDVKFATKQR-----YDSYIGAFQFSEGTLNSMYG---LDLSSNELSGVIPAELGDLFK 783

  Fly   866 LRELYL-HNNMLTHISNATFEPLVSLEVLRLDNNRL-SSLPHLQYRHSLQGLTLGRNAWSCRCQQ 928
            ||.|.| ||.:.:||.: :|..|..:|.|.|..|.| .|:|     |.|..||            
plant   784 LRALNLSHNFLSSHIPD-SFSKLQDIESLDLSYNMLQGSIP-----HQLTNLT------------ 830

  Fly   929 LRELAQF-VSDNAM--VVRDAHDIYCLDAGIKRELELIGN-LANGPDCSDLLDASASNISSSQDL 989
              .||.| ||.|.:  ::.........|     |...:|| |..||.    .|.|.....:|::.
plant   831 --SLAIFNVSYNNLSGIIPQGKQFNTFD-----ENSYLGNPLLCGPP----TDTSCETKKNSEEN 884

  Fly   990 A-GGYRLPLLAAVLVLIF-----------LVVVLIIVFVFRESVRMWLFAHYGVRVCEPRFEDAG 1042
            | ||.......|:.:|:|           |:.:|:::.|.....|.||                 
plant   885 ANGGEEDDKEVAIDMLVFYWSTAGTYVTALIGILVLMCVDCSWRRAWL----------------- 932

  Fly  1043 KLYDAII 1049
            :|.||.|
plant   933 RLVDAFI 939

Known Domains:


GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380 5/35 (14%)
LRR_8 115..181 CDD:290566 18/67 (27%)
leucine-rich repeat 116..146 CDD:275380 8/31 (26%)
leucine-rich repeat 147..170 CDD:275380 4/23 (17%)
leucine-rich repeat 171..201 CDD:275380 9/33 (27%)
LRR_RI 210..464 CDD:238064 84/294 (29%)
leucine-rich repeat 212..236 CDD:275380 8/30 (27%)
LRR_8 235..295 CDD:290566 23/63 (37%)
leucine-rich repeat 237..260 CDD:275380 8/24 (33%)
leucine-rich repeat 261..284 CDD:275380 9/24 (38%)
LRR_8 283..345 CDD:290566 26/75 (35%)
leucine-rich repeat 285..308 CDD:275380 9/24 (38%)
leucine-rich repeat 309..334 CDD:275380 11/25 (44%)
LRR_8 334..393 CDD:290566 25/88 (28%)
leucine-rich repeat 335..358 CDD:275380 11/50 (22%)
leucine-rich repeat 359..382 CDD:275380 8/25 (32%)
LRR_8 382..441 CDD:290566 12/59 (20%)
leucine-rich repeat 383..406 CDD:275380 5/23 (22%)
leucine-rich repeat 407..430 CDD:275380 2/23 (9%)
LRR_8 431..488 CDD:290566 17/81 (21%)
leucine-rich repeat 431..451 CDD:275380 7/22 (32%)
leucine-rich repeat 454..477 CDD:275380 9/45 (20%)
LRR_8 477..559 CDD:290566 22/103 (21%)
leucine-rich repeat 478..499 CDD:275380 2/21 (10%)
leucine-rich repeat 502..525 CDD:275380 8/27 (30%)
leucine-rich repeat 526..548 CDD:275380 6/23 (26%)
leucine-rich repeat 590..617 CDD:275380 3/27 (11%)
leucine-rich repeat 618..641 CDD:275380 7/27 (26%)
leucine-rich repeat 642..689 CDD:275380 5/47 (11%)
LRRCT 679..736 CDD:214507 10/57 (18%)
leucine-rich repeat 775..796 CDD:275380 2/21 (10%)
LRR_8 797..852 CDD:290566 14/78 (18%)
leucine-rich repeat 797..817 CDD:275380 8/43 (19%)
leucine-rich repeat 818..841 CDD:275380 3/23 (13%)
LRR_8 841..900 CDD:290566 20/60 (33%)
leucine-rich repeat 842..865 CDD:275380 6/23 (26%)
LRR_4 866..907 CDD:289563 17/43 (40%)
leucine-rich repeat 866..889 CDD:275380 10/24 (42%)
leucine-rich repeat 890..911 CDD:275380 8/22 (36%)
TIR 1045..1183 CDD:214587 3/6 (50%)
RLP56NP_001330457.1 LRRNT_2 31..75 CDD:311940 2/15 (13%)
PLN00113 55..>868 CDD:331614 229/1019 (22%)
leucine-rich repeat 81..107 CDD:275380 6/26 (23%)
leucine-rich repeat 108..136 CDD:275380 9/43 (21%)
leucine-rich repeat 137..160 CDD:275380 7/23 (30%)
leucine-rich repeat 161..185 CDD:275380 4/24 (17%)
leucine-rich repeat 186..210 CDD:275380 8/30 (27%)
leucine-rich repeat 211..235 CDD:275380 8/24 (33%)
leucine-rich repeat 236..260 CDD:275380 9/24 (38%)
leucine-rich repeat 261..284 CDD:275380 9/24 (38%)
leucine-rich repeat 285..308 CDD:275380 11/25 (44%)
leucine-rich repeat 309..330 CDD:275380 5/21 (24%)
leucine-rich repeat 335..382 CDD:275380 12/50 (24%)
leucine-rich repeat 383..401 CDD:275380 6/41 (15%)
leucine-rich repeat 408..429 CDD:275380 7/21 (33%)
leucine-rich repeat 430..454 CDD:275380 6/24 (25%)
leucine-rich repeat 455..478 CDD:275380 3/23 (13%)
leucine-rich repeat 479..503 CDD:275380 4/28 (14%)
leucine-rich repeat 504..527 CDD:275380 8/27 (30%)
leucine-rich repeat 528..559 CDD:275380 9/31 (29%)
leucine-rich repeat 576..595 CDD:275380 8/48 (17%)
leucine-rich repeat 596..618 CDD:275380 11/70 (16%)
leucine-rich repeat 619..641 CDD:275380 6/22 (27%)
leucine-rich repeat 642..665 CDD:275380 7/42 (17%)
leucine-rich repeat 666..705 CDD:275380 6/54 (11%)
leucine-rich repeat 706..759 CDD:275380 10/58 (17%)
leucine-rich repeat 760..783 CDD:275380 6/26 (23%)
leucine-rich repeat 784..807 CDD:275380 10/24 (42%)
leucine-rich repeat 808..831 CDD:275380 11/42 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1871
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.