DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 18w and Tlr9

Sequence 1:NP_476814.1 Gene:18w FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_112455.2 Gene:Tlr9 MGIID:1932389 Length:1032 Species:Mus musculus

Alignment Length:1134 Identity:261/1135 (23%)
Similarity:412/1135 (36%) Gaps:310/1135 (27%)


  Fly   147 LSELHLGDNNIRQLPEGVWCSMPSLQLLNLTQNRIRSAEFLGFSEKLCAGSALSNANGAVSGGSE 211
            ::.|.|..|.|..|....:..:.:|:.|||..|              |..:.||..:.:.....|
Mouse    65 ITRLSLISNRIHHLHNSDFVHLSNLRQLNLKWN--------------CPPTGLSPLHFSCHMTIE 115

  Fly   212 ---------LQTLDVSFNELRSLPDAWGASRL-RRLQTLSLQHNNISTLAPNALAGLSSLRVL-- 264
                     |:.|::|:|.:.::|      || ..|..|||.|.||..|..|:||||.|||||  
Mouse   116 PRTFLAMRTLEELNLSYNGITTVP------RLPSSLVNLSLSHTNILVLDANSLAGLYSLRVLFM 174

  Fly   265 --NISYNH----LVSLPSEAFAGNKELRELHLQGNDLYELPKGLLHRLEQLLVLDLSGNQLTSHH 323
              |..|.:    .|.:...|..|...|..|.|:.|:|.::|:.|...||.|||            
Mouse   175 DGNCYYKNPCTGAVKVTPGALLGLSNLTHLSLKYNNLTKVPRQLPPSLEYLLV------------ 227

  Fly   324 VDNSTFAGLIRLIVLNLSNNALTRIGSKTFKELYFLQILDMRNN------------SIG----HI 372
                             |.|.:.::|.:....|..|::||:..|            ..|    |:
Mouse   228 -----------------SYNLIVKLGPEDLANLTSLRVLDVGGNCRRCDHAPNPCIECGQKSLHL 275

  Fly   373 EEGAFLPLYNLHTLNLAENRLHTLDNRIFNGLYVLTKLTLNNNLV--SIVESQAFRNCSDLKELD 435
            ....|..|.:|..|.|.::.||||::..|.||..|:.|.|:.|.:  ||..:.||:|.:.|::|:
Mouse   276 HPETFHHLSHLEGLVLKDSSLHTLNSSWFQGLVNLSVLDLSENFLYESITHTNAFQNLTRLRKLN 340

  Fly   436 LSSNQLTEVPEAVQDLSMLKTLDLGENQISEFKN-NTFRNLNQLTGL--RLIDNRIGNITVGMFQ 497
            ||.|...:|..|...|:            |.||| .:.:.|| :.|:  ||::    ..|:....
Mouse   341 LSFNYRKKVSFARLHLA------------SSFKNLVSLQELN-MNGIFFRLLN----KYTLRWLA 388

  Fly   498 DLPRLSVLNLAKNRIQSIERGAFDKNTEIEAIRLDKNFLTDINGIFATLASLLWLNLSENHLVWF 562
            |||:|..|:|..|.|...:.                       .||.|..:|.:::||:|.:.. 
Mouse   389 DLPKLHTLHLQMNFINQAQL-----------------------SIFGTFRALRFVDLSDNRISG- 429

  Fly   563 DYAFIPSNLK----------------WLDIH---------GNYIEALGNYYKLQEEIRVTTLDAS 602
                 ||.|.                ..|.|         .|:::...|:        ..|:|.|
Mouse   430 -----PSTLSEATPEEADDAEQEELLSADPHPAPLSTPASKNFMDRCKNF--------KFTMDLS 481

  Fly   603 HNRITEIGAMSVPN--SIELLFINNNIIGQ-IQANTFVDKTRLARVDLYANVLSKISLNALRVAP 664
            .|.:..|......|  .::.|.:::|.|.| :..:.|:..|.|..:||..|.|......:....|
Mouse   482 RNNLVTIKPEMFVNLSRLQCLSLSHNSIAQAVNGSQFLPLTNLQVLDLSHNKLDLYHWKSFSELP 546

  Fly   665 VSAEKPVPEFYLGGNPFECDCSMEWLQRINNLTTRQHPHVVDLGNIECLMPHSRSAPLRPLASLS 729
               :....:......||    ||:.:.  :|.:     .|..|..::.|             ||:
Mouse   547 ---QLQALDLSYNSQPF----SMKGIG--HNFS-----FVTHLSMLQSL-------------SLA 584

  Fly   730 ASDFVCKYESHCPPTCHCCEYEQCECEVICPGNCSCFHDATWATNIVDCGRQ-DLAALPNRIPQD 793
            .:|...:..||.                    |.:......::.|  ..||. |...|.....|.
Mouse   585 HNDIHTRVSSHL--------------------NSNSVRFLDFSGN--GMGRMWDEGGLYLHFFQG 627

  Fly   794 VSDLY---LDGNNMPELEVGHLTG-RRNLRALYLNASNLMTLQNGSLAQLVNLRVLHLENNKLTA 854
            :|.|.   |..||:..|...:|.. .::|:.|.|..:.|......||:.|.||.||.|..|:|.|
Mouse   628 LSGLLKLDLSQNNLHILRPQNLDNLPKSLKLLSLRDNYLSFFNWTSLSFLPNLEVLDLAGNQLKA 692

  Fly   855 LEGTEFRSLGLLRELYLHNNMLTHISNATFEPLVSLEVLRLDNNRLSSLPHLQYRHSLQGLT--- 916
            |......:..||::|.:.:|.:..:..|.|...|.|:.:.|.:|.|.::....:...:..||   
Mouse   693 LTNGTLPNGTLLQKLDVSSNSIVSVVPAFFALAVELKEVNLSHNILKTVDRSWFGPIVMNLTVLD 757

  Fly   917 LGRNAWSCRCQQLRELAQFVSDNAMVVRDAHDIYCLDAGIKRELELIGNLANGPDCSDLLDASAS 981
            :..|...|.|.     |.||.            ..|:...|     :..||||..|     .|..
Mouse   758 VRSNPLHCACG-----AAFVD------------LLLEVQTK-----VPGLANGVKC-----GSPG 795

  Fly   982 NISSSQDLAGGYRLPL----------LAAVLVLIFLVVVLI-------IVFVFRESVRMWLFAHY 1029
            .:......|...||.|          |:.:.|.:.:||.::       :.:.|...: .||    
Mouse   796 QLQGRSIFAQDLRLCLDEVLSWDCFGLSLLAVAVGMVVPILHHLCGWDVWYCFHLCL-AWL---- 855

  Fly  1030 GVRVCEPRFEDAGKLYDAIILHSEKD---YEFVCRNIAAELE--HGRPPFRLCIQQRD-LPPQAS 1088
             ..:...|.......|||.::..:..   .::|...:...||  .||...|||::.|| ||.|..
Mouse   856 -PLLARSRRSAQTLPYDAFVVFDKAQSAVADWVYNELRVRLEERRGRRALRLCLEDRDWLPGQTL 919

  Fly  1089 HLQLVEGARASRKIILVLTRNLLATEWNRIEFRNAFHESLRGLAQKLVIIEETSVSAEAEDV--- 1150
            ...|......|||.:.||                |..:.:.||.:...::.:..:..:.:||   
Mouse   920 FENLWASIYGSRKTLFVL----------------AHTDRVSGLLRTSFLLAQQRLLEDRKDVVVL 968

  Fly  1151 ------AELSPYLKSVPSNRLLTCDRYFW 1173
                  |..|.|::.  ..||......||
Mouse   969 VILRPDAHRSRYVRL--RQRLCRQSVLFW 995

Known Domains:


GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:290566 10/34 (29%)
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380 5/23 (22%)
leucine-rich repeat 171..201 CDD:275380 8/30 (27%)
LRR_RI 210..464 CDD:238064 82/290 (28%)
leucine-rich repeat 212..236 CDD:275380 7/25 (28%)
LRR_8 235..295 CDD:290566 27/68 (40%)
leucine-rich repeat 237..260 CDD:275380 13/23 (57%)
leucine-rich repeat 261..284 CDD:275380 9/31 (29%)
LRR_8 283..345 CDD:290566 14/62 (23%)
leucine-rich repeat 285..308 CDD:275380 9/23 (39%)
leucine-rich repeat 309..334 CDD:275380 3/25 (12%)
LRR_8 334..393 CDD:290566 15/75 (20%)
leucine-rich repeat 335..358 CDD:275380 4/23 (17%)
leucine-rich repeat 359..382 CDD:275380 8/39 (21%)
LRR_8 382..441 CDD:290566 24/61 (39%)
leucine-rich repeat 383..406 CDD:275380 10/23 (43%)
leucine-rich repeat 407..430 CDD:275380 9/25 (36%)
LRR_8 431..488 CDD:290566 17/60 (28%)
leucine-rich repeat 431..451 CDD:275380 7/20 (35%)
leucine-rich repeat 454..477 CDD:275380 6/24 (25%)
LRR_8 477..559 CDD:290566 19/84 (23%)
leucine-rich repeat 478..499 CDD:275380 5/23 (22%)
leucine-rich repeat 502..525 CDD:275380 5/23 (22%)
leucine-rich repeat 526..548 CDD:275380 3/22 (14%)
leucine-rich repeat 590..617 CDD:275380 6/29 (21%)
leucine-rich repeat 618..641 CDD:275380 6/24 (25%)
leucine-rich repeat 642..689 CDD:275380 10/47 (21%)
LRRCT 679..736 CDD:214507 11/57 (19%)
leucine-rich repeat 775..796 CDD:275380 6/22 (27%)
LRR_8 797..852 CDD:290566 19/59 (32%)
leucine-rich repeat 797..817 CDD:275380 6/24 (25%)
leucine-rich repeat 818..841 CDD:275380 7/23 (30%)
LRR_8 841..900 CDD:290566 19/59 (32%)
leucine-rich repeat 842..865 CDD:275380 8/23 (35%)
LRR_4 866..907 CDD:289563 10/41 (24%)
leucine-rich repeat 866..889 CDD:275380 6/23 (26%)
leucine-rich repeat 890..911 CDD:275380 4/21 (19%)
TIR 1045..1183 CDD:214587 34/145 (23%)
Tlr9NP_112455.2 leucine-rich repeat 43..64 CDD:275380
Interaction with CpG-DNA. {ECO:0000250|UniProtKB:Q2EEY0} 47..51
LRR 1 62..85 5/20 (25%)
LRR_8 63..135 CDD:290566 18/84 (21%)
leucine-rich repeat 65..88 CDD:275380 5/23 (22%)
Interaction with CpG-DNA. {ECO:0000250|UniProtKB:Q2EEY0} 72..77 2/5 (40%)
LRR 2 87..110 8/37 (22%)
Interaction with CpG-DNA. {ECO:0000250|UniProtKB:Q2EEY0} 95..109 4/28 (14%)
LRR 3 122..147 8/31 (26%)
leucine-rich repeat 125..168 CDD:275380 20/49 (41%)
LRR_8 143..211 CDD:290566 27/68 (40%)
LRR 4 150..166 9/16 (56%)
LRR 5 167..190 8/23 (35%)
leucine-rich repeat 169..200 CDD:275380 9/31 (29%)
Interaction with CpG-DNA. {ECO:0000250|UniProtKB:Q2EEY0} 179..181 1/2 (50%)
LRR_RI <194..373 CDD:238064 59/221 (27%)
LRR 6 198..221 7/23 (30%)
LRR_8 199..254 CDD:290566 19/84 (23%)
leucine-rich repeat 201..221 CDD:275380 7/20 (35%)
leucine-rich repeat 222..245 CDD:275380 9/52 (17%)
LRR 7 223..242 7/48 (15%)
LRR 8 243..268 5/25 (20%)
leucine-rich repeat 246..285 CDD:275380 8/39 (21%)
LRR 9 283..306 9/23 (39%)
LRR_8 284..344 CDD:290566 23/60 (38%)
leucine-rich repeat 286..309 CDD:275380 10/23 (43%)
LRR 10 308..332 8/24 (33%)
leucine-rich repeat 310..335 CDD:275380 9/25 (36%)
LRR 11 333..356 7/23 (30%)
leucine-rich repeat 336..365 CDD:275380 12/41 (29%)
LRR 12 363..386 6/28 (21%)
LRR 13 390..413 9/46 (20%)
leucine-rich repeat 393..411 CDD:275380 6/41 (15%)
LRR 14 415..440 7/31 (23%)
LRR 15 471..495 6/32 (19%)
leucine-rich repeat 477..498 CDD:275380 6/21 (29%)
LRR_RI <490..>641 CDD:238064 38/200 (19%)
LRR_8 497..556 CDD:290566 12/62 (19%)
LRR 16 497..520 5/23 (22%)
leucine-rich repeat 499..523 CDD:275380 6/24 (25%)
LRR 17 521..544 6/23 (26%)
leucine-rich repeat 524..547 CDD:275380 6/26 (23%)
LRR 18 546..573 7/41 (17%)
leucine-rich repeat 548..577 CDD:275380 7/40 (18%)
LRR 19 575..599 8/57 (14%)
leucine-rich repeat 578..600 CDD:275380 7/55 (13%)
leucine-rich repeat 601..630 CDD:275380 7/31 (23%)
LRR 20 601..623 5/24 (21%)
LRR_8 <623..690 CDD:290566 21/67 (31%)
LRR 21 628..651 7/23 (30%)
leucine-rich repeat 631..679 CDD:275380 13/48 (27%)
LRR 22 653..676 6/23 (26%)
LRR 23 677..700 10/23 (43%)
leucine-rich repeat 680..703 CDD:275380 8/23 (35%)
LRR 24 702..724 6/22 (27%)
leucine-rich repeat 704..752 CDD:275380 10/48 (21%)
LRR 25 725..748 5/23 (22%)
LRR 26 750..773 8/28 (29%)
leucine-rich repeat 753..774 CDD:275380 8/38 (21%)
TIR_2 870..>974 CDD:304906 27/120 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.