DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 18w and RLP26

Sequence 1:NP_476814.1 Gene:18w FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_180864.1 Gene:RLP26 AraportID:AT2G33050 Length:800 Species:Arabidopsis thaliana

Alignment Length:850 Identity:203/850 (24%)
Similarity:302/850 (36%) Gaps:300/850 (35%)


  Fly   166 CSMPSLQLLNLTQNRIRS-----AEFLGFSEKLCAGSALSNANGAV------SG---GS------ 210
            |....:|.|...:|...|     :::|.       |....|..|||      ||   |:      
plant    28 CLPDQIQALIQFKNEFESDGCNRSDYLN-------GVQCDNTTGAVTKLQLPSGCFTGTLKPNSS 85

  Fly   211 -----ELQTLDVSFNEL--RSLPDAWGASRLRRLQTLSLQHNNISTLAPNALAGLSSLRVLNISY 268
                 :|:.|::|.|..  .|||..:  |.|.||:.|||..::.:...|::::.|..|..||:|:
plant    86 LFELHQLRYLNLSHNNFTSSSLPSEF--SNLTRLEVLSLASSSFTGQVPSSISNLILLTHLNLSH 148

  Fly   269 NHLV-SLPSEAFAGNKELRELHLQGNDLY-ELPKGLLHRLEQLLVLDLSGNQLT-SHHVDNSTFA 330
            |.|. |.|  ......:|..|.|..|... .:|..||..|..|..|||..|.|| |..|.||:.:
plant   149 NELTGSFP--PVRNLTKLSFLDLSYNQFSGAIPFDLLPTLPFLSYLDLKKNHLTGSIDVPNSSSS 211

  Fly   331 GLIRLIVLNLSNNALTRIGSKTFKELYFLQILDMRNNSIGH-IEEGAFLPLYNLHTLNLAENRLH 394
            .  :|:.|:|..|.......:...:|..|..|::.:.:|.| |:...|.||.:|...::.:||| 
plant   212 S--KLVRLSLGFNQFEGKIIEPISKLINLNHLELASLNISHPIDLRVFAPLKSLLVFDIRQNRL- 273

  Fly   395 TLDNRIFNGLYVLTKLTLNNNLVSIVESQAFRNCSDLKELDLSSNQLTEVPEAVQDLSMLKTLDL 459
                                                   |..|.:..:|.|     ||:: :|.|
plant   274 ---------------------------------------LPASLSSDSEFP-----LSLI-SLIL 293

  Fly   460 GENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMFQDLPRLSVLNLAKNRIQSIERGAFD--K 522
            .:..|.||. |.|:.|..|..:.:.:|.|.......|..|||||:.||..|.:...| |:.:  .
plant   294 IQCDIIEFP-NIFKTLQNLEHIDISNNLIKGKVPEWFWKLPRLSIANLVNNSLTGFE-GSSEVLL 356

  Fly   523 NTEIEAIRLDKNFLTDINGIFAT--LASL---LWLN----------LSENHLVWFDYAF------ 566
            |:.::.:....|.:|   |.|.|  |.|:   .|.|          .:.:.|:..|.::      
plant   357 NSSVQLLDFAYNSMT---GAFPTPPLGSIYLSAWNNSFTGNIPLSICNRSSLIVLDLSYNKFTGP 418

  Fly   567 IP---SNLKWLDIHGNYIEALGNYYKLQEEI----RVTTLDASHNRITEIGAMSVPN--SIELLF 622
            ||   ||||.:::..|.:|.     .:.:|.    :..|||..:||:|.....|:.|  |:..|.
plant   419 IPQCLSNLKVVNLRKNSLEG-----SIPDEFHSGAKTQTLDVGYNRLTGKLPKSLLNCSSLRFLS 478

  Fly   623 INNNIIGQIQANTFVDKTRLARVDLYANVLSKISLNALRVAPVSAEKPVPEFYLGGNPFECDCSM 687
            ::||.|    .:||                                           ||      
plant   479 VDNNRI----EDTF-------------------------------------------PF------ 490

  Fly   688 EWLQRINNLTTRQHPHVVDL------GNIECLMPHSRSAPLRPLA-------SLSASDFVCKYES 739
             ||:.:.||      ||:.|      |:   |.|..|.    |||       .||.:.|.    .
plant   491 -WLKALPNL------HVLTLRSNRFFGH---LSPPDRG----PLAFPELRILELSDNSFT----G 537

  Fly   740 HCPPTCHCCEYEQCECEVICPGNCSCFHDATW---ATNIVDCGRQDLAALPNR--IPQDVSDLYL 799
            ..||...                      ..|   :..|.:.||..:....|.  |.:|..||..
plant   538 SLPPNFF----------------------VNWKASSPKINEDGRIYMGDYKNAYYIYEDTMDLQY 580

  Fly   800 DGNNMPELEVGHLTGRRNLRALYLNASNLMTLQNGSLAQLVNLRVLHLENNKLTALEGTEFRSLG 864
            .|                   |::....::|..:          .:....||   |||....|:|
plant   581 KG-------------------LFMEQGKVLTFYS----------TIDFSGNK---LEGQIPESIG 613

  Fly   865 LLRELY---LHNNMLT-HI----SNATFEPLVSLEVLRLDNNRLS--------SLPHLQY----R 909
            ||:||.   |.||..| ||    :|.|     .||.|.|..|:||        ||..|.|    .
plant   614 LLKELIALNLSNNAFTGHIPMSLANVT-----ELESLDLSRNQLSGNIPRELGSLSFLAYISVAH 673

  Fly   910 HSLQG 914
            :.|:|
plant   674 NQLKG 678

Known Domains:


GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:290566 4/15 (27%)
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380 1/4 (25%)
leucine-rich repeat 171..201 CDD:275380 6/35 (17%)
LRR_RI 210..464 CDD:238064 68/271 (25%)
leucine-rich repeat 212..236 CDD:275380 9/26 (35%)
LRR_8 235..295 CDD:290566 19/61 (31%)
leucine-rich repeat 237..260 CDD:275380 6/23 (26%)
leucine-rich repeat 261..284 CDD:275380 8/24 (33%)
LRR_8 283..345 CDD:290566 23/64 (36%)
leucine-rich repeat 285..308 CDD:275380 8/24 (33%)
leucine-rich repeat 309..334 CDD:275380 11/26 (42%)
LRR_8 334..393 CDD:290566 16/60 (27%)
leucine-rich repeat 335..358 CDD:275380 5/23 (22%)
leucine-rich repeat 359..382 CDD:275380 8/24 (33%)
LRR_8 382..441 CDD:290566 6/59 (10%)
leucine-rich repeat 383..406 CDD:275380 4/23 (17%)
leucine-rich repeat 407..430 CDD:275380 0/23 (0%)
LRR_8 431..488 CDD:290566 16/57 (28%)
leucine-rich repeat 431..451 CDD:275380 4/20 (20%)
leucine-rich repeat 454..477 CDD:275380 8/23 (35%)
LRR_8 477..559 CDD:290566 24/99 (24%)
leucine-rich repeat 478..499 CDD:275380 4/21 (19%)
leucine-rich repeat 502..525 CDD:275380 8/25 (32%)
leucine-rich repeat 526..548 CDD:275380 6/24 (25%)
leucine-rich repeat 590..617 CDD:275380 9/33 (27%)
leucine-rich repeat 618..641 CDD:275380 6/23 (26%)
leucine-rich repeat 642..689 CDD:275380 2/47 (4%)
LRRCT 679..736 CDD:214507 19/70 (27%)
leucine-rich repeat 775..796 CDD:275380 6/23 (26%)
LRR_8 797..852 CDD:290566 6/55 (11%)
leucine-rich repeat 797..817 CDD:275380 2/20 (10%)
leucine-rich repeat 818..841 CDD:275380 2/23 (9%)
LRR_8 841..900 CDD:290566 24/67 (36%)
leucine-rich repeat 842..865 CDD:275380 7/23 (30%)
LRR_4 866..907 CDD:289563 21/57 (37%)
leucine-rich repeat 866..889 CDD:275380 11/31 (35%)
leucine-rich repeat 890..911 CDD:275380 11/33 (33%)
TIR 1045..1183 CDD:214587
RLP26NP_180864.1 PLN00113 4..>702 CDD:331614 203/850 (24%)
leucine-rich repeat 92..116 CDD:275380 9/26 (35%)
leucine-rich repeat 117..140 CDD:275380 6/23 (26%)
leucine-rich repeat 141..163 CDD:275380 8/24 (33%)
leucine-rich repeat 164..188 CDD:275380 8/24 (33%)
leucine-rich repeat 189..213 CDD:275380 11/26 (42%)
leucine-rich repeat 214..237 CDD:275380 5/23 (22%)
leucine-rich repeat 238..262 CDD:275380 8/24 (33%)
leucine-rich repeat 263..310 CDD:275380 18/94 (19%)
leucine-rich repeat 311..332 CDD:275380 4/21 (19%)
leucine-rich repeat 335..359 CDD:275380 8/25 (32%)
leucine-rich repeat 379..404 CDD:275380 4/25 (16%)
leucine-rich repeat 405..425 CDD:275380 5/20 (25%)
leucine-rich repeat 426..449 CDD:275380 5/28 (18%)
leucine-rich repeat 450..473 CDD:275380 8/23 (35%)
leucine-rich repeat 474..497 CDD:275380 10/77 (13%)
leucine-rich repeat 525..549 CDD:275380 6/50 (12%)
leucine-rich repeat 578..617 CDD:275380 13/71 (18%)
leucine-rich repeat 618..641 CDD:275380 9/28 (32%)
leucine-rich repeat 642..663 CDD:275380 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1871
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.