DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 18w and RLP24

Sequence 1:NP_476814.1 Gene:18w FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_180861.1 Gene:RLP24 AraportID:AT2G33020 Length:864 Species:Arabidopsis thaliana

Alignment Length:752 Identity:183/753 (24%)
Similarity:281/753 (37%) Gaps:206/753 (27%)


  Fly    49 ESGTGTPLDLQVAEAAGRLDLQCSQELLHASELAPGLFRQLQKLSELR--IDACKLQRVPPNAFE 111
            ::.||....||:.:        |....|.::....| |.||:.|:..|  ..:..|    |:.|.
plant    72 DNSTGAVTVLQLRD--------CLSGTLKSNSSLFG-FHQLRYLALNRNNFTSASL----PSEFC 123

  Fly   112 GLMSLKRLTL-------ESHNAVWGP-------GK--TLELHGQSFQG----------LKELSEL 150
            .|..||.|:|       .|||.:.|.       ||  .|:|....|.|          |..|..|
plant   124 NLNKLKLLSLFSNGFIDLSHNDLMGSFPLVRNLGKLAVLDLSDNHFSGTLNPNNSLFELHSLRYL 188

  Fly   151 HLGDNNIRQLPEGVWCSMPSLQLLNLTQNRIRSAEFLGFSEKLCAGSALSNANGAVSGGSELQTL 215
            :|..|||..       |:|| :..||.:..:.|..|.|||     |....    .:|..:.:..|
plant   189 NLAFNNISS-------SLPS-KFGNLNKLEVLSLSFNGFS-----GQCFP----TISNLTRITQL 236

  Fly   216 DVSFNELR-SLPDAWGASRLRRLQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHL---VSLPS 276
            .:..|||. |.|   ....|.:|..|.|..|..|...|:.|....||..|::..|.|   :.:|:
plant   237 YLHNNELTGSFP---LVQNLTKLSFLGLSDNLFSGTIPSYLFTFPSLSTLDLRENDLSGSIEVPN 298

  Fly   277 EAFAGNKELREL---HLQG--------------------NDLYELPKGLLHRLEQLLVLDLSGNQ 318
            .:.:...|:..|   ||:|                    |..|.:...||..|:.|..||.|||.
plant   299 SSTSSKLEIMYLGFNHLEGKILEPISKLINLKRLDLSFLNTSYPIDLNLLSPLKSLSYLDFSGNS 363

  Fly   319 LTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSKTF----KELYFLQILDMRNNSI-GHIEEGAFL 378
            |:...:.:|::      |.|::.:..|:..|.:.|    |.|..|..:|:.:|.| |.|.|.   
plant   364 LSPASLSSSSY------IPLSMESIVLSLCGIREFPNILKHLQNLIHIDITSNQIKGKIPEW--- 419

  Fly   379 PLYNLHTLNLAENRLHTLDNRIFNGLYVLTKLTLN----------NNL--------VSIVESQAF 425
             |:.|..|:..:     :.|..|||.....::.:|          ||.        :||:...|.
plant   420 -LWTLPQLSFVD-----ISNNSFNGFQGSAEVFVNLSVRILMLDANNFEGALPTLPLSIIGFSAI 478

  Fly   426 RN----------C--SDLKELDLSSNQLT----------------------EVPEAVQDLSMLKT 456
            .|          |  :.|..:|||.|..|                      .:|:.....|.||:
plant   479 HNSFTGEIPLSICNRTSLTMVDLSYNNFTGPIPQCLSNFMFVNLRKNDLEGSIPDTFYTDSSLKS 543

  Fly   457 LDLGENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMFQDLPRLSVLNLAKNR----IQSIER 517
            ||:|.|:::.....:..|.:.|..|.:.:||:.:......:.||.|.||.|..|:    |....:
plant   544 LDVGYNRLTGKLPRSLLNCSSLRFLSVDNNRVKDTFPFWLKALPNLRVLTLRSNKFYGPISPPHQ 608

  Fly   518 GAFDKNTEIEAIRLDKNFLTDINGIFATLASLLWLN-----LSEN-----HLVW-FDYAFIPSNL 571
            |... ..|:....:..|..|      .:|....::|     |::|     ::|: :|.|   :| 
plant   609 GPLG-FPELRIFEIADNMFT------GSLPPSFFVNWKASALTKNEDGGLYMVYEYDKA---AN- 662

  Fly   572 KWLDIHGNYIEALGNYYK--LQEEIRVTT----LDASHNRITEIGAMSVPNSIELL-------FI 623
              ..:...|.:.:...||  ..|:.||.|    :|.|.||:..    .:|.||.||       ..
plant   663 --SPVRYTYTDTIDLQYKGLHMEQERVLTSYAAIDFSGNRLQG----QIPESIGLLKALIALNLS 721

  Fly   624 NNNIIGQIQANTFVDKTRLARVDLYANVLSKISLNAL 660
            ||...|.|.. :|.:...|..:|:..|.||....|.|
plant   722 NNAFTGHIPL-SFANLMNLESLDMSGNQLSGTIPNGL 757

Known Domains:


GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380 6/25 (24%)
leucine-rich repeat 92..115 CDD:275380 6/25 (24%)
LRR_8 115..181 CDD:290566 26/92 (28%)
leucine-rich repeat 116..146 CDD:275380 15/56 (27%)
leucine-rich repeat 147..170 CDD:275380 8/23 (35%)
leucine-rich repeat 171..201 CDD:275380 8/30 (27%)
LRR_RI 210..464 CDD:238064 81/338 (24%)
leucine-rich repeat 212..236 CDD:275380 7/25 (28%)
LRR_8 235..295 CDD:290566 19/86 (22%)
leucine-rich repeat 237..260 CDD:275380 7/23 (30%)
leucine-rich repeat 261..284 CDD:275380 5/26 (19%)
LRR_8 283..345 CDD:290566 20/85 (24%)
leucine-rich repeat 285..308 CDD:275380 9/46 (20%)
leucine-rich repeat 309..334 CDD:275380 8/25 (32%)
LRR_8 334..393 CDD:290566 17/64 (27%)
leucine-rich repeat 335..358 CDD:275380 7/27 (26%)
leucine-rich repeat 359..382 CDD:275380 8/24 (33%)
LRR_8 382..441 CDD:290566 19/89 (21%)
leucine-rich repeat 383..406 CDD:275380 6/23 (26%)
leucine-rich repeat 407..430 CDD:275380 8/53 (15%)
LRR_8 431..488 CDD:290566 19/79 (24%)
leucine-rich repeat 431..451 CDD:275380 7/42 (17%)
leucine-rich repeat 454..477 CDD:275380 7/23 (30%)
LRR_8 477..559 CDD:290566 20/96 (21%)
leucine-rich repeat 478..499 CDD:275380 4/21 (19%)
leucine-rich repeat 502..525 CDD:275380 7/27 (26%)
leucine-rich repeat 526..548 CDD:275380 3/22 (14%)
leucine-rich repeat 590..617 CDD:275380 9/31 (29%)
leucine-rich repeat 618..641 CDD:275380 8/30 (27%)
leucine-rich repeat 642..689 CDD:275380 7/20 (35%)
LRRCT 679..736 CDD:214507
leucine-rich repeat 775..796 CDD:275380
LRR_8 797..852 CDD:290566
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
LRR_8 841..900 CDD:290566
leucine-rich repeat 842..865 CDD:275380
LRR_4 866..907 CDD:289563
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
RLP24NP_180861.1 leucine-rich repeat 103..137 CDD:275380 11/38 (29%)
PLN00113 139..>799 CDD:331614 163/673 (24%)
leucine-rich repeat 159..184 CDD:275380 5/25 (20%)
leucine-rich repeat 185..208 CDD:275380 11/31 (35%)
leucine-rich repeat 209..232 CDD:275380 7/32 (22%)
leucine-rich repeat 233..255 CDD:275380 7/25 (28%)
leucine-rich repeat 256..279 CDD:275380 7/23 (30%)
leucine-rich repeat 280..304 CDD:275380 5/24 (21%)
leucine-rich repeat 305..328 CDD:275380 5/23 (22%)
leucine-rich repeat 329..353 CDD:275380 5/24 (21%)
leucine-rich repeat 402..423 CDD:275380 8/25 (32%)
leucine-rich repeat 426..450 CDD:275380 6/29 (21%)
leucine-rich repeat 472..495 CDD:275380 4/23 (17%)
leucine-rich repeat 496..516 CDD:275380 6/20 (30%)
leucine-rich repeat 517..540 CDD:275380 2/23 (9%)
leucine-rich repeat 541..564 CDD:275380 7/23 (30%)
leucine-rich repeat 565..588 CDD:275380 6/23 (26%)
leucine-rich repeat 616..690 CDD:275380 17/86 (20%)
leucine-rich repeat 691..714 CDD:275380 9/27 (33%)
leucine-rich repeat 715..738 CDD:275380 5/24 (21%)
leucine-rich repeat 739..762 CDD:275380 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1871
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.