DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 18w and tlr22

Sequence 1:NP_476814.1 Gene:18w FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_001122147.2 Gene:tlr22 ZFINID:ZDB-GENE-040220-5 Length:955 Species:Danio rerio

Alignment Length:1168 Identity:254/1169 (22%)
Similarity:406/1169 (35%) Gaps:349/1169 (30%)


  Fly   102 LQRVPPNAF---EGLMSLKRLTLESHNAVWGPGKTLELHGQSFQGLKELSELHLGDNNIRQLPEG 163
            :.|||.|.:   ....|..::.:|..|.                 |..|..|::.:|.|.::.:|
Zfish    61 IPRVPNNTWILDISFNSFAQIQIEDLNI-----------------LLNLQYLNVSNNKISKIQDG 108

  Fly   164 VWCSMPSLQLLNLTQNRIRSAEFLGFSEKLCAGSALSNANGAVSGGSELQTLDVSFNELRSLPDA 228
            .:.|:.:|..|||..||:.:.                 :||.:.|                    
Zfish   109 AFGSLFNLTDLNLASNRLNAV-----------------SNGMLRG-------------------- 136

  Fly   229 WGASRLRRLQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPS-EAFAGNKELRELHLQG 292
                 |..|..|.|..|.||.:..:|.:.|.||:|||:|.|||..:.. :....:..|.||::..
Zfish   137 -----LTNLLVLRLDRNYISVIKESAFSTLHSLQVLNLSKNHLRHIDDVKPVLASLYLEELYIGS 196

  Fly   293 N--------DLYELPKGLLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALT--R 347
            |        :|...|..|..       ||||.|:..:..:.|:.|..|..|.:....:|...  .
Zfish   197 NYFNVFNSSELSTKPLSLKR-------LDLSNNRFAAFQLTNNIFPTLNHLDLSYCGHNGTMAWN 254

  Fly   348 IGSKTF----KELYFL----------QILDMRNNSIGHIEEGAFLPLYN-----------LHTLN 387
            :..|::    |.|||:          .:|...||::..|.....:.|..           |..|.
Zfish   255 VTEKSYLASVKTLYFMDVNMSIQTADNVLQSFNNTLNKIRLNGNVRLNKTSLLLSVCSPMLRVLR 319

  Fly   388 LAENRLHTLDNRIFNGLYVLTKLTLNNNLVSIVESQAFRNCSDLKELDLSSNQLTEVPEAVQDLS 452
            |...::..|.|.:|:....|::|.|..|.:|.:....||....||:|.|..|:||.|..:.|.|:
Zfish   320 LIATKIKHLTNHMFDPCSELSELDLGGNEISNLSQSMFRGFKQLKKLQLQINKLTRVTNSFQILT 384

  Fly   453 MLKTLDLGENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMFQDLPRLSVLNLAKNRIQSIER 517
            .|:.:||..|.|.:...|.|.||.|:..|.|..|:|.:|...:|:||..|.||.|..|.:..|:.
Zfish   385 SLEFIDLSRNHIHKLSCNDFANLTQVKTLYLYSNKISSIRSCLFKDLKSLEVLRLGTNNLLKIDD 449

  Fly   518 GAFDKNTEIEAIRLDKNFLTDING-IFATLASLLWLNLSENHLVWFDYAFIPSNLKWLDIHGNYI 581
            ...:....::.::|..|.|:.|.. .|..|..|..|:|.:|.:              .:|.|...
Zfish   450 VFSNGPYFLKELQLSYNKLSLIKSHTFGNLPQLNNLSLEDNQI--------------SEIEGYAF 500

  Fly   582 EALGNYYKLQEEIRVTTLDASHNRITEIGAMSVPNSIELLFINNNIIGQIQANTFVDKTRLARVD 646
            ..|.|         :|:|..|.|:||.....:.|                  |.|.....|..:|
Zfish   501 GGLEN---------LTSLFLSSNKITGKTLTTHP------------------NVFSGMPNLQNLD 538

  Fly   647 LYANVLSKISLNALRVAPVSAEKPVPEFYLGGNPFECDCSMEWLQRINNLTTRQHPHVVDLGNIE 711
            |:||.:|                           |..|             ..::|...||.|:.
Zfish   539 LFANSIS---------------------------FAYD-------------KLKYPLFKDLKNLR 563

  Fly   712 CLMPHSRSAPLRPLASLSASDFVCKYESHCPPTCHCCEYEQCECEVICPGNCSCFHDATWATNIV 776
            .|..:|:                                                          
Zfish   564 ELSLYSQ---------------------------------------------------------- 570

  Fly   777 DCGRQDLAALPNRIPQDVSDLYLDGNNMPELEVGHLTGRRNLRALYLNASNLMTLQNGSLAQLVN 841
               |:.:..||:.:                     |.|..:|:..|:..:||..|..........
Zfish   571 ---RRGIGQLPSNL---------------------LEGLSSLQMFYIGNTNLNQLNPNLFNFTPQ 611

  Fly   842 LRVLHLENNKL---TALEGTEFRSLGLLRELYLHNNMLTHISNATFEPLVSLEVLRLDNNR---- 899
            |..|.|..|.|   .|:....|..:..|.:|.:....|..::......|..|..||...|.    
Zfish   612 LWFLDLSKNALREDDAIPPELFHPIPNLTKLIISRTQLRSLNFLLGANLNKLSTLRASGNEIDSV 676

  Fly   900 ----LSSLPHLQYRHSLQGLTLGRNAWSCRCQQLRELAQFVSDNAMVVRDAHDIYCLDAGIKREL 960
                :.|||.|..      |.|..|.::|.|           :||         :.:|...|.|.
Zfish   677 NETLIKSLPRLAV------LDLQNNTFTCDC-----------NNA---------FFIDWAKKNES 715

  Fly   961 ELIGNLANGPDCSDLLDASASNISSSQDLAGGYRLPLLAAVLVLIFLVVVLIIVFVFRESVRMWL 1025
            ..:..|:. ..||.......::::.....:..:....:..|...|.:::.|::.|:       |.
Zfish   716 TQVYYLSR-YTCSYPRTLRGTSLAEFNTDSCTFNWDYICFVCSSILVILTLLLSFI-------WN 772

  Fly  1026 FAHYGV---------RVCEPRFEDAGKL--YDAIILHSEKDYEFVCRNIAAELEHGRPPFRLCIQ 1079
            |..|.|         .:.:.|...:|:.  |||.|.::..|..:|...:..:|| |...:|||:.
Zfish   773 FLRYQVVYTYYLFLAFLYDSRRNQSGQTFQYDAFISYNTLDEAWVMEELIPKLE-GEQGWRLCLH 836

  Fly  1080 QRDLPPQASHL-QLVEGARASRKIILVLTRNLLATEWNRIEFRNA----FHESLRGLAQKLVIIE 1139
            .||..|....: .:|:|..:|||.|.::|||.|.:.|...|.:.|    |.|      ||.|:| 
Zfish   837 HRDFEPGRPIIDNIVDGIYSSRKTICLITRNYLKSNWCSSEVQVASFRLFDE------QKDVLI- 894

  Fly  1140 ETSVSAEAEDVAELSPY--LKSVPSNRLL-------TCDRYFWEKLRYAIPIELSPRGNNYTL 1193
              .|..|.....:||||  |:.:...|..       ..::.||:||:.|:..:.|.:..|..|
Zfish   895 --LVFLEDIPTHQLSPYHRLRKLVKKRTYIRWPKPGEDNKIFWQKLKMALETKDSHKSENCIL 955

Known Domains:


GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380 4/16 (25%)
LRR_8 115..181 CDD:290566 16/66 (24%)
leucine-rich repeat 116..146 CDD:275380 3/30 (10%)
leucine-rich repeat 147..170 CDD:275380 6/23 (26%)
leucine-rich repeat 171..201 CDD:275380 6/30 (20%)
LRR_RI 210..464 CDD:238064 72/290 (25%)
leucine-rich repeat 212..236 CDD:275380 1/24 (4%)
LRR_8 235..295 CDD:290566 21/69 (30%)
leucine-rich repeat 237..260 CDD:275380 8/23 (35%)
leucine-rich repeat 261..284 CDD:275380 8/24 (33%)
LRR_8 283..345 CDD:290566 17/70 (24%)
leucine-rich repeat 285..308 CDD:275380 7/31 (23%)
leucine-rich repeat 309..334 CDD:275380 8/25 (32%)
LRR_8 334..393 CDD:290566 15/86 (17%)
leucine-rich repeat 335..358 CDD:275380 6/29 (21%)
leucine-rich repeat 359..382 CDD:275380 5/33 (15%)
LRR_8 382..441 CDD:290566 18/70 (26%)
leucine-rich repeat 383..406 CDD:275380 6/23 (26%)
leucine-rich repeat 407..430 CDD:275380 7/23 (30%)
LRR_8 431..488 CDD:290566 23/57 (40%)
leucine-rich repeat 431..451 CDD:275380 9/20 (45%)
leucine-rich repeat 454..477 CDD:275380 9/23 (39%)
LRR_8 477..559 CDD:290566 25/83 (30%)
leucine-rich repeat 478..499 CDD:275380 7/21 (33%)
leucine-rich repeat 502..525 CDD:275380 6/23 (26%)
leucine-rich repeat 526..548 CDD:275380 6/23 (26%)
leucine-rich repeat 590..617 CDD:275380 7/27 (26%)
leucine-rich repeat 618..641 CDD:275380 2/23 (9%)
leucine-rich repeat 642..689 CDD:275380 8/47 (17%)
LRRCT 679..736 CDD:214507 8/57 (14%)
leucine-rich repeat 775..796 CDD:275380 3/21 (14%)
LRR_8 797..852 CDD:290566 11/55 (20%)
leucine-rich repeat 797..817 CDD:275380 2/20 (10%)
leucine-rich repeat 818..841 CDD:275380 5/23 (22%)
LRR_8 841..900 CDD:290566 15/70 (21%)
leucine-rich repeat 842..865 CDD:275380 7/26 (27%)
LRR_4 866..907 CDD:289563 12/49 (24%)
leucine-rich repeat 866..889 CDD:275380 4/23 (17%)
leucine-rich repeat 890..911 CDD:275380 8/29 (28%)
TIR 1045..1183 CDD:214587 47/152 (31%)
tlr22NP_001122147.2 leucine-rich repeat 71..91 CDD:275380 4/37 (11%)
LRR_8 91..150 CDD:290566 20/101 (20%)
leucine-rich repeat 92..115 CDD:275380 6/23 (26%)
leucine-rich repeat 116..139 CDD:275380 10/65 (15%)
LRR_8 138..199 CDD:290566 21/61 (34%)
leucine-rich repeat 140..163 CDD:275380 8/23 (35%)
leucine-rich repeat 164..213 CDD:275380 14/49 (29%)
leucine-rich repeat 214..338 CDD:275380 27/131 (21%)
LRR_8 337..396 CDD:290566 21/59 (36%)
leucine-rich repeat 339..362 CDD:275380 7/23 (30%)
LRR_RI <363..494 CDD:238064 44/145 (30%)
leucine-rich repeat 363..385 CDD:275380 10/22 (45%)
LRR_8 384..444 CDD:290566 23/60 (38%)
leucine-rich repeat 386..409 CDD:275380 9/23 (39%)
leucine-rich repeat 410..433 CDD:275380 8/23 (35%)
LRR_8 432..492 CDD:290566 16/60 (27%)
leucine-rich repeat 434..457 CDD:275380 6/23 (26%)
leucine-rich repeat 458..481 CDD:275380 6/23 (26%)
LRR_RI 461..700 CDD:238064 70/408 (17%)
LRR_8 480..544 CDD:290566 22/105 (21%)
leucine-rich repeat 482..505 CDD:275380 7/37 (19%)
leucine-rich repeat 506..533 CDD:275380 9/45 (20%)
leucine-rich repeat 534..561 CDD:275380 11/67 (16%)
LRR_8 560..622 CDD:290566 17/144 (12%)
leucine-rich repeat 562..587 CDD:275380 7/107 (7%)
leucine-rich repeat 588..606 CDD:275380 5/18 (28%)
leucine-rich repeat 612..638 CDD:275380 7/26 (27%)
LRR_8 637..695 CDD:290566 14/64 (22%)
leucine-rich repeat 639..662 CDD:275380 4/23 (17%)
leucine-rich repeat 663..686 CDD:275380 7/23 (30%)
leucine-rich repeat 687..705 CDD:275380 8/44 (18%)
TIR 802..945 CDD:214587 47/153 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128590
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.