DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 18w and Slitrk5

Sequence 1:NP_476814.1 Gene:18w FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:XP_006252506.1 Gene:Slitrk5 RGDID:1310957 Length:983 Species:Rattus norvegicus

Alignment Length:1089 Identity:223/1090 (20%)
Similarity:354/1090 (32%) Gaps:396/1090 (36%)


  Fly   338 LNLSNNALTRIGSKTFKELYFLQILDMRNNSIGHIEEGAFLPLYNLHTLNLAENRLHTLDNRIFN 402
            |.||.|.|.|:....|.......||.:.:|.|..||.|||..|..|..|:|..|:|..|.:..|.
  Rat   111 LLLSGNLLNRLYPNEFVNYTGASILHLGSNVIQDIETGAFHGLRGLRRLHLNNNKLELLRDDTFL 175

  Fly   403 GLYVLTKLTLNNNLVSIVESQAFRNCSDLKELDLSSNQLTEVPEAVQDLSMLKTLDLGENQISEF 467
            ||..|..|.::.|.:|::|                       |.|...|.||:.|.|.:|.:|..
  Rat   176 GLENLEYLQVDYNYISVIE-----------------------PNAFGKLHMLQVLILNDNLLSGL 217

  Fly   468 KNNTFRNLNQLTGLRLIDNRIGNIT-VGMFQDLPRLSVLNLAKNRIQSIERGAFDKNTEIEAIRL 531
            .||.||.: .||.|.|..||:..:. ||:.|.:.::..|.|.:|          ..|...|.|.|
  Rat   218 PNNLFRFV-PLTHLDLRGNRLKLLPYVGLLQHMDKVVELQLEEN----------PWNCSCELISL 271

  Fly   532 DKNFLTDINGIFATLASLLWL-NLSENHLVWFDYAFIPSNLKWLDIHGNYIEALGNY-------- 587
            ..                 || ::|.:.||.......|..|     ||..::.:...        
  Rat   272 KD-----------------WLDSISYSALVGDVVCETPFRL-----HGRDLDEVSKQELCPRKLI 314

  Fly   588 --YKLQEEIRVTTLDASHNRITEIGAMSVPNSIELLFINNNIIGQIQANTFVDKTRLARVDLYAN 650
              |:::.:..::|....|.....:.:::..:|                                 
  Rat   315 SDYEMRPQTPLSTTGYLHTTPASVNSVATSSS--------------------------------- 346

  Fly   651 VLSKISLNALRVAPVSAEKPVPEFYLGGNPFECDCSMEWLQRINNLTTRQHPHVVDLGNIECLMP 715
                    |:...|:...|                           .||| |:          .|
  Rat   347 --------AVYKPPLKPPK---------------------------GTRQ-PN----------KP 365

  Fly   716 HSRSAPLRPLASLSASDF--VCKYESHCPPTCHCCEYEQCECEVICPGNCSC---FHDATWATNI 775
            ..|....:|...|..|::  ...|::..|            ..:.||..|:|   ..|.....|.
  Rat   366 RVRPTSRQPSKDLGYSNYGPSIAYQTKSP------------VPLECPTACTCNLQISDLGLNVNC 418

  Fly   776 VDCGRQDLAALPNRIPQDVSDLYLDGNNMPELEVGHLTGRRNLRALYLNASNLMTLQNGSLAQLV 840
            .:...:.:|.|..: |.:...:||..|.:..:..........|..|:|..:.:..:|:.:...|.
  Rat   419 QERKIESIAELQPK-PYNPKKMYLTENYITVVRRTDFLEATGLDLLHLGNNRISMIQDRAFGDLG 482

  Fly   841 NLRVLHLENNKLTALEGTEFRSLGLLRELYLHNNMLTHISNATFEPLVSLEVLRLDNNRLSSLPH 905
            |||.|:|..|::..|....|..|..|:.|:|..|::..|.:.||:|:.:|::|.|:||:|.::|.
  Rat   483 NLRRLYLNGNRIERLSPELFYGLQSLQYLFLQYNLIREIQSGTFDPVPNLQLLFLNNNQLQAMPS 547

  Fly   906 LQYRHSLQGLTLGR------------------------------NAWSCRCQQLRELAQFVSDNA 940
            ..:    .||||.|                              |.|.|.|:.:...........
  Rat   548 GVF----SGLTLLRLNLRSNSFTSLPVSGVLDQLTSLIQIDLHDNPWDCTCEVVGMKLWIEQLKV 608

  Fly   941 MVVRDAHDIYC---------LDAGIKRELELIGNLANGPDCSDLLDA----------SASNISSS 986
            .|:.|  ::.|         ....||.||..       ||.||::.:          |.:|.:::
  Rat   609 GVLVD--EVICKAPKKFAETYMRSIKSELLC-------PDYSDVVVSTPTPSSIQLPSRTNAAAT 664

  Fly   987 QDL--------------AGGYRLPLLAAVLVLIFLVVVLIIVFVFR------------------- 1018
            ..:              .|...:||  :||:|..|:|.::.|||..                   
  Rat   665 PAVKLNSTGTPAGLGAGTGASSVPL--SVLILSLLLVFIMSVFVAAGLFVLVMKRRKKNQSDHTS 727

  Fly  1019 ------ESVRMWLFAHYG---------------------VRVCEPRFEDAGKLYDAI---ILH-- 1051
                  .|..| .::.||                     .:|..|    ||.:|:.|   :.|  
  Rat   728 TNNSDVSSFNM-QYSVYGGGGGGGGGHPHAHVHHRGSALPKVKTP----AGHVYEYIPHPLGHMC 787

  Fly  1052 -----------SEKDYE-----FVCRNIAAELEHGRPPFRLCIQQRDLPPQASHLQLVEGARASR 1100
                       |.:||:     .|..:....|:..:||.....||:. |||   |||..|..   
  Rat   788 KNPIYRSREGNSVEDYKDLHELKVTYSSNHHLQQQQPPPPQQPQQQP-PPQ---LQLQPGEE--- 845

  Fly  1101 KIILVLTRNLLATEWNRIEFRNAFHESLRGLAQKLVIIEETSVSAEAEDVAELSPYLKSVPSNRL 1165
                              |.|.:.|  ||..|..:..||      ..||:  |||         :
  Rat   846 ------------------ERRESHH--LRSPAYSVSTIE------PREDL--LSP---------V 873

  Fly  1166 LTCDRYFWEKLRYAIPIELSPRGNNYTLDHHERFKQPVSPGMIFRQAPPPPAYYCTEEMEANYSS 1230
            ...||::...|........:|.|:  :|..:.:|  |.||                        :
  Rat   874 QDADRFYRGILEPDKHCSTTPAGS--SLPEYPKF--PCSP------------------------A 910

  Fly  1231 ATTATPSPRPTRP-------GGAARIVDSMPMPMRPPSEHIYHSIESEY 1272
            |.|.:|:....||       .|.:|:.:  |:...||.........:||
  Rat   911 AYTFSPNYDLRRPHQYLHPGAGESRLRE--PVLYSPPGAVFVEPNRNEY 957

Known Domains:


GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:290566
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..201 CDD:275380
LRR_RI 210..464 CDD:238064 39/126 (31%)
leucine-rich repeat 212..236 CDD:275380
LRR_8 235..295 CDD:290566
leucine-rich repeat 237..260 CDD:275380
leucine-rich repeat 261..284 CDD:275380
LRR_8 283..345 CDD:290566 4/7 (57%)
leucine-rich repeat 285..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
LRR_8 334..393 CDD:290566 21/55 (38%)
leucine-rich repeat 335..358 CDD:275380 7/20 (35%)
leucine-rich repeat 359..382 CDD:275380 10/23 (43%)
LRR_8 382..441 CDD:290566 14/59 (24%)
leucine-rich repeat 383..406 CDD:275380 9/23 (39%)
leucine-rich repeat 407..430 CDD:275380 5/23 (22%)
LRR_8 431..488 CDD:290566 19/57 (33%)
leucine-rich repeat 431..451 CDD:275380 2/20 (10%)
leucine-rich repeat 454..477 CDD:275380 9/23 (39%)
LRR_8 477..559 CDD:290566 19/84 (23%)
leucine-rich repeat 478..499 CDD:275380 9/22 (41%)
leucine-rich repeat 502..525 CDD:275380 4/23 (17%)
leucine-rich repeat 526..548 CDD:275380 3/22 (14%)
leucine-rich repeat 590..617 CDD:275380 2/27 (7%)
leucine-rich repeat 618..641 CDD:275380 0/23 (0%)
leucine-rich repeat 642..689 CDD:275380 3/47 (6%)
LRRCT 679..736 CDD:214507 9/59 (15%)
leucine-rich repeat 775..796 CDD:275380 3/21 (14%)
LRR_8 797..852 CDD:290566 14/55 (25%)
leucine-rich repeat 797..817 CDD:275380 3/20 (15%)
leucine-rich repeat 818..841 CDD:275380 5/23 (22%)
LRR_8 841..900 CDD:290566 22/59 (37%)
leucine-rich repeat 842..865 CDD:275380 8/23 (35%)
LRR_4 866..907 CDD:289563 15/41 (37%)
leucine-rich repeat 866..889 CDD:275380 8/23 (35%)
leucine-rich repeat 890..911 CDD:275380 7/21 (33%)
TIR 1045..1183 CDD:214587 35/159 (22%)
Slitrk5XP_006252506.1 leucine-rich repeat 87..104 CDD:275380
leucine-rich repeat 108..131 CDD:275380 7/20 (35%)
LRR_8 109..166 CDD:290566 21/55 (38%)
leucine-rich repeat 132..155 CDD:275380 10/23 (43%)
LRR_8 154..214 CDD:290566 22/83 (27%)
leucine-rich repeat 156..179 CDD:275380 9/23 (39%)
leucine-rich repeat 180..203 CDD:275380 8/46 (17%)
LRR_8 204..261 CDD:290566 21/68 (31%)
leucine-rich repeat 204..225 CDD:275380 9/21 (43%)
leucine-rich repeat 227..251 CDD:275380 9/24 (38%)
LRRCT 260..>298 CDD:214507 14/70 (20%)
LRR_8 458..518 CDD:290566 18/60 (30%)
LRR_4 458..499 CDD:289563 12/41 (29%)
leucine-rich repeat 460..483 CDD:275380 5/23 (22%)
LRR_4 483..523 CDD:289563 14/40 (35%)
leucine-rich repeat 484..507 CDD:275380 8/23 (35%)
leucine-rich repeat 508..553 CDD:275380 16/49 (33%)
leucine-rich repeat 555..579 CDD:275380 2/24 (8%)
TPKR_C2 588..>624 CDD:301599 7/38 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 182 1.000 Inparanoid score I3819
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.