DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 18w and Lrrc66

Sequence 1:NP_476814.1 Gene:18w FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_705796.1 Gene:Lrrc66 MGIID:2387634 Length:872 Species:Mus musculus

Alignment Length:947 Identity:195/948 (21%)
Similarity:325/948 (34%) Gaps:277/948 (29%)


  Fly   196 GSALSNANGAVSGGSELQTLDVSFNELRSL--PDAWGASRLRRLQTLSLQHNNISTLAPNALAGL 258
            |..|.|.:...........:|.||...|.|  |.   ..:.|.::.....|:.||.:..:.||.|
Mouse    40 GDLLVNWSSIRHVSQNTDAMDRSFYFFRVLFQPH---TQKERHIKPPDRTHHRISKVTLDPLAHL 101

  Fly   259 SSLRVLNISYN--HLVSL-----PS---EAFAGNK-----ELRELHLQGNDLYELPKGLLHRLEQ 308
            .:|.:||:|..  |..||     ||   :...|:.     .|:.|.||.|.|...||| |.:|:.
Mouse   102 HALEILNLSNKAIHYFSLDQPLPPSSHQKRHGGHSHSRLPRLQVLILQRNQLSGTPKG-LWKLKS 165

  Fly   309 LLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSKTFKELYFLQILDMRNNSIGHIE 373
            |..||||.|::.  |:..|.|.|.::|..:.|.:|.:..|..|.||.|..||::|:|:|::..:.
Mouse   166 LRSLDLSFNRIV--HIGLSDFHGCLQLESIYLKSNKICTIHPKAFKGLKKLQVVDLRSNALTTLV 228

  Fly   374 EGAFLPLYNLH-TLNLAENRLHTLDNRI-FNGL---------YVLTKLTLNNNLVSIVESQAFRN 427
            ....:.|...| .|.||:|:....::.: |..:         ..:..:::.|...: .|:...|.
Mouse   229 PIVTIALELPHLELGLADNQWQCSESNVNFQNITSSSWREIWKAICNMSVENKRPN-AETHQIRK 292

  Fly   428 C----------SDLKELDLSSNQLTEVPEAVQDL----------------------SMLKTLDLG 460
            .          ||||.|..|.   .|.|:|..|:                      |.::..|..
Mouse   293 SRDTHLLLSPPSDLKSLIQSK---AERPQAGMDMHLSALGKEAKDGYGDLRGMWPQSPVELRDSQ 354

  Fly   461 ENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMFQDLPRLSVLNLAKNRIQSIERGAFDKNTE 525
            :.|:::.|::....|.....|.:....:....:|.|   .|..:..|.:.|..:...|:.:..: 
Mouse   355 DEQVTDRKDDKPPALELAICLSVFITFVVAFCLGAF---ARPYIDRLRQQRCSNKRPGSDNAYS- 415

  Fly   526 IEAIRLDKNFLTDING----------IFATLASLLWLNLSEN-HLVWF----------------- 562
                  :|.|..||.|          :..|...   |:|||| :..|.                 
Mouse   416 ------NKGFHGDIEGAQHMEYQGTDLHQTTHH---LHLSENQNPSWVAEPIPHSAVQSEQMLGS 471

  Fly   563 -----------------------DYAFIPSN-LKWLDIHG-------NYIEALGNYYKLQEEIRV 596
                                   |...:||. :..|.:||       ..|..:.:::...||...
Mouse   472 NGTDPGHQQSPEQLKDSNESRSGDSIVLPSGPVAHLALHGLPNADAHKAISPVQHHHDFLEEAHY 536

  Fly   597 TTLDASHNRITEIGAMSVPNSIELLFINNNIIGQIQANTFVDKTRLARVDLYAN-------VLSK 654
            .|:...::.|.::            ...::|.|.:  .||.......|.||:.:       ..||
Mouse   537 DTVAQEYSLIDDV------------MDRSSITGPL--GTFPSSVESRRDDLHPSQPRDVVASFSK 587

  Fly   655 ISLNA-LRVAPVSAEKPVPEFYLGGNPFECDCSMEWLQRINN----LTTRQHPHV--VD----LG 708
            ...:| .|.|..|.|...|| .||....:...|.|  ::::|    |.|:| |..  ||    |.
Mouse   588 TLAHANTREAEGSMETGCPE-PLGAMDSQMGSSEE--RQVSNSIRELATQQ-PSFQGVDAEERLS 648

  Fly   709 NIECLMPHSRSAPLRPLASLSASDFVCKYESHCPPTCHCCEYEQCECEVICPGNCSCFHDATWAT 773
            ::...:.|:....|||                                             .|.:
Mouse   649 HVYSEVLHNDPPSLRP---------------------------------------------RWGS 668

  Fly   774 NIVDCGRQDLAALPNRIPQDVS-DLYLD--GNNMPELEVGHL-----TGRRNLRALYLNASNLMT 830
                 |...:.|....:.:|.. |.:.|  .|...:.:.|.|     .|..:.|:|   |....:
Mouse   669 -----GHYVIPATGEPVERDAPFDPHYDLVTNYESDSDEGSLFTLSSEGSEDTRSL---AEEQAS 725

  Fly   831 LQNGSLAQLVNLRVLHLENNKLTALEGTEFRSLGLL------RELYLHNNMLTHISNATFEPLVS 889
            ::|...:|.:..|.|....:.:|:.|..|..:...:      :|.:|.|.:::...:...|....
Mouse   726 VENDGTSQPLPSRNLGEYKDSVTSAESVEDLTSQRIPEKCEAQEAHLRNTLISGPDSCVCETNQE 790

  Fly   890 LEVLRLDNNRLSSLPHLQYRHSLQGLTLGRNAWSCRCQQLRELAQFVSDNAMVVRDAHDIYCLDA 954
            .:...||....|:.|.|.........|||...      .:...::.|        |.|  |.|  
Mouse   791 NDSSSLDPENRSTWPQLPGHKLSHHETLGTYG------DIEPQSEAV--------DWH--YSL-- 837

  Fly   955 GIKRELELIGNLANGPDCSDLLDASASNISSSQDLAG 991
               |:||           |..:|:|.|...|.:||:|
Mouse   838 ---RDLE-----------SPNVDSSPSPPYSDEDLSG 860

Known Domains:


GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:290566
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..201 CDD:275380 2/5 (40%)
LRR_RI 210..464 CDD:238064 80/314 (25%)
leucine-rich repeat 212..236 CDD:275380 7/26 (27%)
LRR_8 235..295 CDD:290566 22/75 (29%)
leucine-rich repeat 237..260 CDD:275380 6/23 (26%)
leucine-rich repeat 261..284 CDD:275380 10/38 (26%)
LRR_8 283..345 CDD:290566 24/67 (36%)
leucine-rich repeat 285..308 CDD:275380 11/23 (48%)
leucine-rich repeat 309..334 CDD:275380 10/25 (40%)
LRR_8 334..393 CDD:290566 19/60 (32%)
leucine-rich repeat 335..358 CDD:275380 8/23 (35%)
leucine-rich repeat 359..382 CDD:275380 6/23 (26%)
LRR_8 382..441 CDD:290566 15/80 (19%)
leucine-rich repeat 383..406 CDD:275380 6/34 (18%)
leucine-rich repeat 407..430 CDD:275380 4/33 (12%)
LRR_8 431..488 CDD:290566 14/79 (18%)
leucine-rich repeat 431..451 CDD:275380 8/20 (40%)
leucine-rich repeat 454..477 CDD:275380 4/23 (17%)
LRR_8 477..559 CDD:290566 18/93 (19%)
leucine-rich repeat 478..499 CDD:275380 3/21 (14%)
leucine-rich repeat 502..525 CDD:275380 3/23 (13%)
leucine-rich repeat 526..548 CDD:275380 6/32 (19%)
leucine-rich repeat 590..617 CDD:275380 4/27 (15%)
leucine-rich repeat 618..641 CDD:275380 4/23 (17%)
leucine-rich repeat 642..689 CDD:275380 16/55 (29%)
LRRCT 679..736 CDD:214507 14/67 (21%)
leucine-rich repeat 775..796 CDD:275380 3/22 (14%)
LRR_8 797..852 CDD:290566 12/62 (19%)
leucine-rich repeat 797..817 CDD:275380 5/27 (19%)
leucine-rich repeat 818..841 CDD:275380 5/23 (22%)
LRR_8 841..900 CDD:290566 11/65 (17%)
leucine-rich repeat 842..865 CDD:275380 5/23 (22%)
LRR_4 866..907 CDD:289563 9/47 (19%)
leucine-rich repeat 866..889 CDD:275380 4/29 (14%)
leucine-rich repeat 890..911 CDD:275380 5/21 (24%)
TIR 1045..1183 CDD:214587
Lrrc66NP_705796.1 leucine-rich repeat 104..142 CDD:275380 10/38 (26%)
LRR_RI <138..247 CDD:238064 39/112 (35%)
LRR_8 <138..176 CDD:290566 17/39 (44%)
LRR 1 142..164 11/23 (48%)
leucine-rich repeat 143..165 CDD:275380 11/23 (48%)
LRR_8 164..224 CDD:290566 23/62 (37%)
LRR 2 165..186 9/23 (39%)
leucine-rich repeat 166..189 CDD:275380 10/25 (40%)
LRR 3 189..210 7/21 (33%)
leucine-rich repeat 190..213 CDD:275380 8/23 (35%)
LRR 4 213..234 5/21 (24%)
LRR 5 239..259 6/20 (30%)
leucine-rich repeat 240..263 CDD:275380 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.