DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 18w and pan-1

Sequence 1:NP_476814.1 Gene:18w FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_497925.1 Gene:pan-1 WormBaseID:WBGene00003915 Length:594 Species:Caenorhabditis elegans

Alignment Length:595 Identity:144/596 (24%)
Similarity:232/596 (39%) Gaps:157/596 (26%)


  Fly   142 QGLKELSELH------LGDNNIRQLPEGVWCSMPSLQLLNLTQNRIRSAEFLGFSEKLCAGSALS 200
            :|.||....|      ..||.|....:|......|..:.::::|                   |:
 Worm    29 KGFKEEFNAHKQPVCICADNGIFSTVKGFTIECESASIASVSEN-------------------LA 74

  Fly   201 NANGAVSGGSELQTLDVSFNELRSLPDAWGASRLRRLQTLSLQHNNISTLAPNALAGLSSLRVLN 265
            :.|     |:||..|.:..:.:..||.....:...:  .:.|:...:|||.||:.          
 Worm    75 SLN-----GTELGRLTIRDSTVNVLPQDLFENVFAK--QVKLERCGLSTLQPNSF---------- 122

  Fly   266 ISYNHLVSLPSEAFAGNKELRELHLQGNDLYELPKGLLHRLEQLLVLDLSGNQLTSHHVDNSTFA 330
                       ::..|:.||  |.|:.|.:.:|.|||                            
 Worm   123 -----------QSLGGSAEL--LSLRENRIKKLEKGL---------------------------- 146

  Fly   331 GLIRLIVLNLSNNALTRIGSKTFKELYFLQILDMRNNSIGHIEEGAFLPLYNLHTLNLAENRLHT 395
                                  |..|..|:.||:..|.|..|:.|||..|..:..|.|.||.:..
 Worm   147 ----------------------FTGLKSLKTLDLAMNKIQEIDVGAFEELKKVEELLLNENDIRV 189

  Fly   396 LDNRIFNGLYVLTKLTLNNNLVSIVESQAFRNCSDLKELDLSSNQLTEVPEAV-QDLSMLKTLDL 459
            |....|:|:..|.||||.|..:.|::..|||..:.|::|.||:|.|..:...: ..|..|:.|||
 Worm   190 LKTGTFDGMKNLKKLTLQNCNLEIIQKGAFRGLNSLEQLILSNNNLENIDWTIFSALKNLRVLDL 254

  Fly   460 GENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMFQDLPRLSVLNLAKNRIQSIERGAFD--- 521
            |.|:||..:..:|..|.:|.   |.:|.|.::.....:|||.|.|....:|:|:||  |..|   
 Worm   255 GSNKISNVEMKSFPKLEKLV---LNNNTIDSMKSIKLKDLPSLVVALFDRNKIESI--GDMDMFG 314

  Fly   522 --KNTEIEAIRLDKNFLTDINGIFATLASLLWLNLSENHLVWFDYAFIPSNLKWLDIHGNYIEAL 584
              ::..||.:.|.:|                  |||:.....|.:.   .||..|.:..|.||.|
 Worm   315 LTRSDRIETLSLARN------------------NLSQISPKAFQHT---PNLITLLLQYNQIEEL 358

  Fly   585 GNYYKLQEEI-------RVTTLDASHNRITEIGAMSVPNSIELLFINNNIIGQIQANTFVDKTRL 642
            .::...|...       ::.||..|.|.::.|.:..:|.|:..|.:::|:|.:|:|.. ::...:
 Worm   359 SSHSPSQVRTPFLASLKKLVTLQLSSNNLSVIRSDELPKSLSSLALDHNVISKIEARA-LEGMEI 422

  Fly   643 ARVDLYANVLSKISLNALRVAPVSAEKP--VPEFYLGGNPFECDCS--MEWLQRINNLTTRQHPH 703
            .|:.|::|     .||.|......:..|  |....:..||:.|.|:  .|||.|.  |...:...
 Worm   423 KRLYLHSN-----KLNYLYQGTFDSFSPKSVEAVDVSLNPWVCVCNDPKEWLPRW--LEASEEAD 480

  Fly   704 VVDLGNIECL 713
            |.: |.:.||
 Worm   481 VAE-GALGCL 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:290566 10/45 (22%)
leucine-rich repeat 116..146 CDD:275380 2/4 (50%)
leucine-rich repeat 147..170 CDD:275380 5/29 (17%)
leucine-rich repeat 171..201 CDD:275380 2/30 (7%)
LRR_RI 210..464 CDD:238064 63/255 (25%)
leucine-rich repeat 212..236 CDD:275380 4/24 (17%)
LRR_8 235..295 CDD:290566 12/60 (20%)
leucine-rich repeat 237..260 CDD:275380 6/23 (26%)
leucine-rich repeat 261..284 CDD:275380 1/23 (4%)
LRR_8 283..345 CDD:290566 9/62 (15%)
leucine-rich repeat 285..308 CDD:275380 8/23 (35%)
leucine-rich repeat 309..334 CDD:275380 0/25 (0%)
LRR_8 334..393 CDD:290566 16/59 (27%)
leucine-rich repeat 335..358 CDD:275380 2/23 (9%)
leucine-rich repeat 359..382 CDD:275380 10/23 (43%)
LRR_8 382..441 CDD:290566 22/59 (37%)
leucine-rich repeat 383..406 CDD:275380 7/23 (30%)
leucine-rich repeat 407..430 CDD:275380 10/23 (43%)
LRR_8 431..488 CDD:290566 20/58 (34%)
leucine-rich repeat 431..451 CDD:275380 6/21 (29%)
leucine-rich repeat 454..477 CDD:275380 10/23 (43%)
LRR_8 477..559 CDD:290566 22/87 (25%)
leucine-rich repeat 478..499 CDD:275380 5/21 (24%)
leucine-rich repeat 502..525 CDD:275380 8/28 (29%)
leucine-rich repeat 526..548 CDD:275380 4/22 (18%)
leucine-rich repeat 590..617 CDD:275380 7/34 (21%)
leucine-rich repeat 618..641 CDD:275380 5/23 (22%)
leucine-rich repeat 642..689 CDD:275380 13/51 (25%)
LRRCT 679..736 CDD:214507 13/38 (34%)
leucine-rich repeat 775..796 CDD:275380
LRR_8 797..852 CDD:290566
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
LRR_8 841..900 CDD:290566
leucine-rich repeat 842..865 CDD:275380
LRR_4 866..907 CDD:289563
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
pan-1NP_497925.1 LRR_RI 80..326 CDD:238064 84/326 (26%)
leucine-rich repeat 81..104 CDD:275380 4/23 (17%)
leucine-rich repeat 105..128 CDD:275380 7/46 (15%)
leucine-rich repeat 130..152 CDD:275380 11/74 (15%)
LRR_8 132..187 CDD:290566 23/105 (22%)
leucine-rich repeat 153..176 CDD:275380 10/23 (43%)
leucine-rich repeat 177..200 CDD:275380 7/23 (30%)
LRR_8 199..259 CDD:290566 23/60 (38%)
leucine-rich repeat 201..224 CDD:275380 10/23 (43%)
LRR_RI 224..434 CDD:238064 65/242 (27%)
leucine-rich repeat 225..248 CDD:275380 7/23 (30%)
leucine-rich repeat 249..269 CDD:275380 9/20 (45%)
LRR_8 268..355 CDD:290566 28/113 (25%)
leucine-rich repeat 270..293 CDD:275380 8/26 (31%)
leucine-rich repeat 294..320 CDD:275380 8/28 (29%)
LRR_8 320..387 CDD:290566 20/88 (23%)
leucine-rich repeat 321..344 CDD:275380 8/44 (18%)
LRR_8 375..432 CDD:290566 15/63 (24%)
leucine-rich repeat 377..398 CDD:275380 6/21 (29%)
leucine-rich repeat 399..420 CDD:275380 5/22 (23%)
leucine-rich repeat 423..442 CDD:275380 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.