DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: 18w and Tlr3

Sequence 1:NP_476814.1 Gene:18w FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_001344245.1 Gene:Tlr3 MGIID:2156367 Length:905 Species:Mus musculus

Alignment Length:1113 Identity:239/1114 (21%)
Similarity:397/1114 (36%) Gaps:318/1114 (29%)


  Fly   109 AFEGLMSLKRLTLESHNAVWGPGKTLELHGQSFQGLKELSELHLGDNNIRQLPEGVWCSMPS-LQ 172
            :|.||:||..|.:.|.|..     |:..:......||           :..:|:    .:|| :.
Mouse    11 SFGGLLSLWILLVSSTNQC-----TVRYNVADCSHLK-----------LTHIPD----DLPSNIT 55

  Fly   173 LLNLTQNRIRSAEFLGFSEKLCAGSALSNANGAVSGGSELQTLDVSFNELRSL-PDAWGASRLRR 236
            :||||.|::|......|:..                 |:|..||..||.:..| |:.  ...|..
Mouse    56 VLNLTHNQLRRLPPTNFTRY-----------------SQLAILDAGFNSISKLEPEL--CQILPL 101

  Fly   237 LQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGNDLYELPKG 301
            |:.|:||||.:|.::.......::|..|::..|.:..:.|..|...|.|.:|.|..|.|.....|
Mouse   102 LKVLNLQHNELSQISDQTFVFCTNLTELDLMSNSIHKIKSNPFKNQKNLIKLDLSHNGLSSTKLG 166

  Fly   302 LLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSKTFKELYFLQILDMRN 366
            ...:||.|..|.|:.|::.:...:...|.|...|..|:||:|.|.......|:.:..|..|.:.|
Mouse   167 TGVQLENLQELLLAKNKILALRSEELEFLGNSSLRKLDLSSNPLKEFSPGCFQTIGKLFALLLNN 231

  Fly   367 NSIG-HIEEGAFLPLYN--LHTLNLAENRLHTLDNRIFNGLYVLTKLTLNNNLVSIVESQAFRNC 428
            ..:. |:.|.....|.|  :..|:||.|:|.......|:||                      ..
Mouse   232 AQLNPHLTEKLCWELSNTSIQNLSLANNQLLATSESTFSGL----------------------KW 274

  Fly   429 SDLKELDLSSNQLTEVPE-AVQDLSMLKTLDLGENQISEFKNNTFRNLNQLTGLRLIDNRI---- 488
            ::|.:||||.|.|.:|.. :...|..|:.|.|..|.|......:|..|:.|..|.|  .|.    
Mouse   275 TNLTQLDLSYNNLHDVGNGSFSYLPSLRYLSLEYNNIQRLSPRSFYGLSNLRYLSL--KRAFTKQ 337

  Fly   489 -------GNITVGMFQDLPRLSVLNLAKNRIQSIERGAFDKNTEIEAIRLDKNFL---TDINGIF 543
                   .||....||.|..|..||:..|.|.|.:...|.....::.:.|.|.|.   |..|..|
Mouse   338 SVSLASHPNIDDFSFQWLKYLEYLNMDDNNIPSTKSNTFTGLVSLKYLSLSKTFTSLQTLTNETF 402

  Fly   544 ATLA--SLLWLNLSENHL--------VWFDYAFIPSNLKWLDIHGNYIEALGNYYKLQ-EEIRVT 597
            .:||  .||.|||::||:        .|.      ..|:.||:..|.||     .||. :|.|  
Mouse   403 VSLAHSPLLTLNLTKNHISKIANGTFSWL------GQLRILDLGLNEIE-----QKLSGQEWR-- 454

  Fly   598 TLDASHNRITEIGAMSVPNSIELLFINNNIIGQIQANTFVDKTRLARVDLYANVLSKISLNALRV 662
                           .:.|..| ::::.|...|:..::|.....|.|:     :|.:::|..:.:
Mouse   455 ---------------GLRNIFE-IYLSYNKYLQLSTSSFALVPSLQRL-----MLRRVALKNVDI 498

  Fly   663 APVSAEKPVPEFYLGGNPFECDCSMEWLQRINNLTTRQHPHVVDLGNIECLMPHSRSAPLRPLAS 727
            :|                                                       :|.|||.:
Mouse   499 SP-------------------------------------------------------SPFRPLRN 508

  Fly   728 LSASDFVCKYESHCPPTCHCCEYEQCECEVICPGNCSCFHDATWATNIVDCGRQDLAALPNRIPQ 792
            |:..|                                                            
Mouse   509 LTILD------------------------------------------------------------ 513

  Fly   793 DVSDLYLDGNNMPELEVGHLTGRRNLRALYLNASNLMTLQNGS--------LAQLVNLRVLHLEN 849
                  |..||:..:....|.|..||..|....:||..|...:        |..|.:|.:|:||:
Mouse   514 ------LSNNNIANINEDLLEGLENLEILDFQHNNLARLWKRANPGGPVNFLKGLSHLHILNLES 572

  Fly   850 NKLTALEGTEFRSLGLLRELYLHNNMLTHISNATFEPLVSLEVLRLDNNRLSSL------PHLQY 908
            |.|..:....|::|..|:.:.|..|.|..:....|:...||..|.|..|.::|:      |..| 
Mouse   573 NGLDEIPVGVFKNLFELKSINLGLNNLNKLEPFIFDDQTSLRSLNLQKNLITSVEKDVFGPPFQ- 636

  Fly   909 RHSLQGLTLGRNAWSCRCQQLRELAQFVSDNAMVVRDAHDIYCLDAGIKRELELIGNLANGPDCS 973
              :|..|.:..|.:.|.|:.:.....:::.....:.:....|               |.|.|...
Mouse   637 --NLNSLDMRFNPFDCTCESISWFVNWINQTHTNISELSTHY---------------LCNTPHHY 684

  Fly   974 DLLDASASNISSSQDLAGGYRLPLLAAVLVLIFLVVVLIIVFVFRESVRMWLFAHY--------- 1029
            ........:.||.:|.|....|.:::..::|:|::|||:|      .:..|..:.|         
Mouse   685 YGFPLKLFDTSSCKDSAPFELLFIISTSMLLVFILVVLLI------HIEGWRISFYWNVSVHRIL 743

  Fly  1030 GVRVCEPRFEDAGKLYDAIILHSEKDYEFVCRNIAAELEHGRPPFRLCIQQRDLPPQASHLQ-LV 1093
            |.:..:.:.|...  |.|.|:|:.||.::|..:. :.:|......:.|:::||.......|: :|
Mouse   744 GFKEIDTQAEQFE--YTAYIIHAHKDRDWVWEHF-SPMEEQDQSLKFCLEERDFEAGVLGLEAIV 805

  Fly  1094 EGARASRKIILVLTRNLLATE-WNRIEFRNAFHESLRGLAQKLVIIEETSVSAEAEDVAELSPYL 1157
            ...:.|||||.|:|.:||... ..|.:..:|..:::......:::|                 :|
Mouse   806 NSIKRSRKIIFVITHHLLKDPLCRRFKVHHAVQQAIEQNLDSIILI-----------------FL 853

  Fly  1158 KSVPSNRL 1165
            :::|..:|
Mouse   854 QNIPDYKL 861

Known Domains:


GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380 3/6 (50%)
LRR_8 115..181 CDD:290566 16/67 (24%)
leucine-rich repeat 116..146 CDD:275380 7/30 (23%)
leucine-rich repeat 147..170 CDD:275380 2/23 (9%)
leucine-rich repeat 171..201 CDD:275380 7/30 (23%)
LRR_RI 210..464 CDD:238064 71/259 (27%)
leucine-rich repeat 212..236 CDD:275380 8/25 (32%)
LRR_8 235..295 CDD:290566 17/60 (28%)
leucine-rich repeat 237..260 CDD:275380 7/23 (30%)
leucine-rich repeat 261..284 CDD:275380 6/23 (26%)
LRR_8 283..345 CDD:290566 20/62 (32%)
leucine-rich repeat 285..308 CDD:275380 8/23 (35%)
leucine-rich repeat 309..334 CDD:275380 6/25 (24%)
LRR_8 334..393 CDD:290566 18/62 (29%)
leucine-rich repeat 335..358 CDD:275380 7/23 (30%)
leucine-rich repeat 359..382 CDD:275380 6/24 (25%)
LRR_8 382..441 CDD:290566 15/61 (25%)
leucine-rich repeat 383..406 CDD:275380 8/23 (35%)
leucine-rich repeat 407..430 CDD:275380 0/23 (0%)
LRR_8 431..488 CDD:290566 20/58 (34%)
leucine-rich repeat 431..451 CDD:275380 8/21 (38%)
leucine-rich repeat 454..477 CDD:275380 7/23 (30%)
LRR_8 477..559 CDD:290566 31/98 (32%)
leucine-rich repeat 478..499 CDD:275380 8/32 (25%)
leucine-rich repeat 502..525 CDD:275380 7/23 (30%)
leucine-rich repeat 526..548 CDD:275380 8/27 (30%)
leucine-rich repeat 590..617 CDD:275380 4/28 (14%)
leucine-rich repeat 618..641 CDD:275380 4/23 (17%)
leucine-rich repeat 642..689 CDD:275380 5/47 (11%)
LRRCT 679..736 CDD:214507 6/57 (11%)
leucine-rich repeat 775..796 CDD:275380 0/21 (0%)
LRR_8 797..852 CDD:290566 18/63 (29%)
leucine-rich repeat 797..817 CDD:275380 5/20 (25%)
leucine-rich repeat 818..841 CDD:275380 7/31 (23%)
LRR_8 841..900 CDD:290566 18/59 (31%)
leucine-rich repeat 842..865 CDD:275380 8/23 (35%)
LRR_4 866..907 CDD:289563 12/47 (26%)
leucine-rich repeat 866..889 CDD:275380 5/23 (22%)
leucine-rich repeat 890..911 CDD:275380 7/27 (26%)
TIR 1045..1183 CDD:214587 28/124 (23%)
Tlr3NP_001344245.1 leucine-rich repeat 37..53 CDD:275380 5/31 (16%)
LRR 1 53..74 7/21 (33%)
leucine-rich repeat 54..77 CDD:275380 8/40 (20%)
PLN00113 70..>543 CDD:331614 142/671 (21%)
LRR 2 77..98 7/23 (30%)
leucine-rich repeat 78..101 CDD:275380 8/25 (32%)
LRR 3 101..122 7/21 (33%)
leucine-rich repeat 102..125 CDD:275380 7/23 (30%)
LRR 4 125..146 5/21 (24%)
leucine-rich repeat 126..149 CDD:275380 6/23 (26%)
LRR 5 149..170 6/21 (29%)
leucine-rich repeat 150..199 CDD:275380 14/49 (29%)
LRR 6 173..196 5/23 (22%)
LRR 7 199..220 7/21 (33%)
leucine-rich repeat 200..250 CDD:275380 14/50 (28%)
LRR 8 250..271 6/21 (29%)
leucine-rich repeat 251..276 CDD:275380 8/47 (17%)
LRR 9 276..297 8/21 (38%)
leucine-rich repeat 277..300 CDD:275380 9/23 (39%)
LRR 10 300..321 6/21 (29%)
leucine-rich repeat 301..324 CDD:275380 7/23 (30%)
LRR 11 324..345 4/23 (17%)
leucine-rich repeat 325..381 CDD:275380 16/58 (28%)
LRR 12 357..378 7/21 (33%)
LRR 13 381..401 5/20 (25%)
leucine-rich repeat 382..433 CDD:275380 16/57 (28%)
LRR 14 409..430 7/21 (33%)
LRR 15 433..454 9/26 (35%)
leucine-rich repeat 434..458 CDD:275380 10/46 (22%)
LRR 16 458..479 5/22 (23%)
leucine-rich repeat 459..482 CDD:275380 4/24 (17%)
LRR 17 482..502 5/80 (6%)
leucine-rich repeat 483..508 CDD:275380 9/85 (11%)
LRR 18 508..529 6/87 (7%)
leucine-rich repeat 509..532 CDD:275380 7/89 (8%)
LRR 19 532..553 6/21 (29%)
leucine-rich repeat 533..564 CDD:275380 7/31 (23%)
LRR 20 564..585 7/21 (33%)
leucine-rich repeat 565..586 CDD:275380 7/21 (33%)
LRR 21 588..609 5/21 (24%)
leucine-rich repeat 589..610 CDD:275378 5/21 (24%)
LRR 22 612..633 6/21 (29%)
leucine-rich repeat 613..637 CDD:275380 7/27 (26%)
LRRCT 646..698 CDD:214507 9/67 (13%)
TIR 756..901 CDD:214587 28/127 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.