DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and CG10553

DIOPT Version :8

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_651383.1 Gene:CG10553 / 43064 FlyBaseID:FBgn0039324 Length:414 Species:Drosophila melanogaster

Alignment Length:429 Identity:113/430 (26%)
Similarity:198/430 (46%) Gaps:58/430 (13%)


  Fly     2 LPNWLTEEYLQPKLRAYYKDDQLKVVK-VWAKPATEKGQNYMSLMTRIHVEIQQGDGLLQNRTYI 65
            :|:|:.....:..|:...||  .|..| :.|......|:||.::|.||.:::::.|.....:.::
  Fly    17 IPDWVKPTVFEELLKRIVKD--YKATKSMRANAGVAAGENYATVMLRIELDVEKEDNTQTTKAFM 79

  Fly    66 IKESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNELLQEVGLTGKFTADTIFVDREYRTIILE 130
            :|.....: ...||..:.|:::.|..||..::|::.:|.::|||..||.|:...::.....::||
  Fly    80 LKTPHQSE-QYRKVIEKTDIFDVERGMYVEVVPELEQLYRDVGLEVKFGAELYDIEASDYYVLLE 143

  Fly   131 DLAQYNYVNADRVKQLDLAHTKLTLEVLAKFHAASIV---VKQRHPELLTKSLFIHCFSRDNKGY 192
            ||....:.|.||::.:|.|||:..|:..|::||||.|   .|..:.|..||.     |.|:    
  Fly   144 DLRPRGFGNIDRLEGMDQAHTECVLKKFAQWHAASAVRVETKGPYQEKYTKG-----FLRN---- 199

  Fly   193 TEVYEGVLSAFIR-----FINEQPVLK--KKYGNKLQKIHENIMDYGARTFEVGE-------QEL 243
                |.::.|||.     |::...:.|  :.|.|.|:.:       ..:|||:.|       .|.
  Fly   200 ----EEIVDAFINRSIKVFLDNVHLCKGYETYLNDLRIV-------SGKTFEIVESLNNPSPDEF 253

  Fly   244 LTLSHGDCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLRDEVQDME-SVLVE 307
            :.|:|||.|..|.:.||:.....|....:|.|...:.|...||:.|...|...:::..: ...:.
  Fly   254 IALNHGDGWANNIMSQYNTKGEIQDTYFVDLQVPKWGSVTQDLYYFLLSSTSLDIKTSKFDYFIW 318

  Fly   308 KYYSDLKTNVDTLSYKGIFPSLQGFQ---KQFESRRFMC---LLAH-LFKPVIIYDGTEVSSDFS 365
            .|:|:|..::..|.|....|:|:...   .::....|:|   :||: |..||   ||    :||.
  Fly   319 FYHSELVKHLKLLGYSKTLPTLRRINDALNKYSGWSFICTATILAYVLLDPV---DG----ADFD 376

  Fly   366 SVYKDTEEGIRFQKAIYANERVLKSATKLLAMLDAKGVL 404
            .|..|  :...|:.::|.|.|..|....||..|..:|.:
  Fly   377 KVLGD--DDCSFKNSLYINPRFRKHMEVLLPWLQHRGAM 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 80/303 (26%)
CG10553NP_651383.1 EcKinase 52..333 CDD:281023 80/302 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55968
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.