DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and CG13360

DIOPT Version :8

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_569859.1 Gene:CG13360 / 31025 FlyBaseID:FBgn0025620 Length:421 Species:Drosophila melanogaster

Alignment Length:429 Identity:114/430 (27%)
Similarity:195/430 (45%) Gaps:48/430 (11%)


  Fly     3 PNWLTEEYLQPKLRAYYKDDQLKVVK-VWAKPATEKGQNYMSLMTRIHVEIQQGDGLLQNRTYII 66
            |.:|.|::.:..|....:|.::.:.| ::::.:...|:||.|.:.|.....:.....|.....:|
  Fly    15 PKYLNEDFFKAALEDGLRDMRVDIKKIIFSESSGGGGENYCSKIYRAKALYRSSKRQLDEELALI 79

  Fly    67 KESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNELLQEVGLTGKFTADTIFVDRE-YRTIILE 130
            .:|:: ..|..:...|..||.||...|..:|.|:..|   :|...||.|..::..|| .:||:.:
  Fly    80 VKSIA-ITPATQFLEELAVYLREKIFYFDVLGKLEVL---IGDGSKFGAKCLYTTREPIQTIVFD 140

  Fly   131 DLAQYNYVNADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRHP---ELLTKSLFIHCFSRDNKGY 192
            ||.||.|..|.|...|:..|..:.|:.|.||||:|:|:.::.|   |..|..:....:.|.|:  
  Fly   141 DLTQYGYKLASRQSGLNEEHCVVILKKLGKFHASSMVLAEKEPSVREHFTTGMLDENYIRTNE-- 203

  Fly   193 TEVYEGVLSAFIRFINEQ-----PVLKKKYGNKL--QKIH---ENIMDYGARTFEVGEQELLTLS 247
                     .||.|:..|     .|:.|..|.:|  :|:|   :||.:....|......|:..|:
  Fly   204 ---------RFINFMTLQCRTLANVVSKWPGYELLAEKLHRHCDNIKENLVTTGRPLPGEITVLN 259

  Fly   248 HGDCWTTNFLYQYDD--ASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLR-DEVQDMESVLVEKY 309
            |||.|..||:|:|||  .:.|..|:.:|||.|.|.||..|::.|...|:: |.:......|::.|
  Fly   260 HGDLWVNNFMYKYDDEQPTKPIDAIFVDFQNSFFGSPGCDINFFLNSSVQLDVLIHRREFLIQTY 324

  Fly   310 YSDLKTNVDTLSYKGIFPSLQGFQKQFESRR-FMCLLAHLFKPVII------YD-GTEVSSDFSS 366
            |:.|:.:::.: :....||....|::..:|. :....::.|.|::.      || ..|..||...
  Fly   325 YASLRDSLERM-HSAFVPSYADIQQEIRARELYGFFSSYAFLPMVTMKKEDSYDISIEALSDQDF 388

  Fly   367 VYKDTEEGIRFQKAIYANERVLKSATKLLAMLDAKGVLN 405
            ..|      :.|....:|.|...:....|...|..|:.:
  Fly   389 AKK------KVQLMFSSNPRTTDTLRYALRRFDDLGIFD 421

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 90/302 (30%)
CG13360NP_569859.1 EcKinase 50..335 CDD:281023 90/300 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C60034
eggNOG 1 0.900 E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D343262at33208
OrthoFinder 1 1.000 FOG0000118
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11012
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.