DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and nhr-246

DIOPT Version :8

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001256661.1 Gene:nhr-246 / 191499 WormBaseID:WBGene00014192 Length:386 Species:Caenorhabditis elegans

Alignment Length:429 Identity:85/430 (20%)
Similarity:162/430 (38%) Gaps:121/430 (28%)


  Fly     6 LTEEYLQPKLRAYYKDDQLKVVKVWAKPA---------TEKGQNYMSLMTRIHVEIQQGDGLLQN 61
            ||:|:|.          :|..:|:..||.         :|.|  :|||:.::.:.....|  |..
 Worm    11 LTKEWLA----------ELIEIKIGVKPKIGTVGILENSELG--FMSLLRKVRLHFDNDD--LPK 61

  Fly    62 RTYIIKESLSEDCPQAK-----------VFLEYDVYNREMDMYEFILPKMNELLQEVGLT----- 110
            ...:.....::.|...:           ..:|..::|.|.:.|: :...::|...::..|     
 Worm    62 HVVLKIPQNTKGCSVVENAGGGVKNVDHSVVERFMHNTECNYYK-LFSSLSEKPLQIPTTYLASK 125

  Fly   111 --GKFTADTIFVDREYRTIILEDLAQYNYV---NADRVKQLDLAHTKLTLEVLAKFHAASIVV-- 168
              .|.....|.::      :|||...::.:   |.|::.::        ::.|.|.|..|:..  
 Worm   126 AGEKAPVPVIVLE------MLEDCKLHDLIPGFNEDQLFKI--------VDELVKLHIFSLTTEK 176

  Fly   169 -KQRHPE--LLTKSLFIHCFSRD--NKGYTEVYEGVLSAFI-RFINEQPVLKKKYGNKLQKIHEN 227
             |:..|:  .|..|.|:.|...|  .|.......||:.::: ..::..|       |.|||:.: 
 Worm   177 WKEIVPDESKLAMSGFLQCMVADVGRKLAQNPELGVILSYVENTLDTDP-------NYLQKMRD- 233

  Fly   228 IMDYGARTFEVGEQELLTLSHGDCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTV 292
              :|      :.|:....:.|||.|....|:..:|    ..|..:|:|.::..||:.|||..  :
 Worm   234 --EY------INEERPSVICHGDLWAPQILWDKED----NIAGIVDWQATHRGSPMEDLHHI--L 284

  Fly   293 SLRDEVQDMESV---LVEKYYSDLKTNVDTLSYKGIFPSLQGFQKQFESRRFMCLLAHLFKPVII 354
            |....||:.::.   |::.||:.||..   |..||                        ||....
 Worm   285 STCTSVQNRKTFTKPLLDHYYNKLKVG---LKEKG------------------------FKTTWT 322

  Fly   355 YDGTEVSSDFSSVYKDTEEGIRFQKAIYANERVLKSATK 393
            .:..::..::|.:|..:.  ..|....:||..||::..|
 Worm   323 REEIDIEYNYSFIYGASR--TIFANGFWANSPVLQTDGK 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 64/317 (20%)
nhr-246NP_001256661.1 CHK 134..314 CDD:214734 50/219 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.