DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and H37A05.2

DIOPT Version :8

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_506379.1 Gene:H37A05.2 / 186806 WormBaseID:WBGene00010426 Length:419 Species:Caenorhabditis elegans

Alignment Length:355 Identity:67/356 (19%)
Similarity:138/356 (39%) Gaps:79/356 (22%)


  Fly    35 TEKGQNYMSLMTRIHVEIQQGDGLLQNRTYIIKESLSEDCPQAKVFLEYDVYNREMDMYEFIL-- 97
            ||..||   |..||.|::.....|....|.:..|:...:..::...|..:::|||:|||..|:  
 Worm    66 TENAQN---LPDRIAVKMSSELSLYNFSTLVSSETWDIEKMKSMTSLVKELHNREVDMYRIIMRE 127

  Fly    98 ----PKMNEL----------------------LQEVGLTGKFTADTIFVDREYRTIILEDLAQYN 136
                |.:|.|                      |..||:....:.:.|:.       :::.:|.::
 Worm   128 KPACPTVNVLSLEAFTELSPLKAYIISEYIPNLHHVGMNDCISIEEIWA-------VVDGIAAFS 185

  Fly   137 ----YVNADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRHPELLTKSLFIHCFSRDNKGYTEVYE 197
                .::.|..|:..:.  ::.:|...|:     ....:.|:.:.|:|.:..    ...|.|..|
 Worm   186 AMGESMSEDEKKKSTIG--EIYIEEAVKY-----FFDDQSPDNMRKNLIMIL----GVAYEEKVE 239

  Fly   198 GVLSAFIRFINEQPVLKKKYGNKLQKIHENIMDYGARTFEVGEQELLTLSHGDCWTTNFLYQYDD 262
            ..:..|..:..         .:::||.:..:..:      :|...:  |.|.|.|.:|.|:....
 Worm   240 EAMDIFDLYCG---------SSEIQKNYSRVSAF------LGHSPV--LMHSDIWPSNLLFSLSS 287

  Fly   263 ASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSL-RDEVQDMESVLVEKYYSDLKTNVDTLSYKGIF 326
            .:..:....||||.::.:||..|:.......| :.:.:.::|.::::||.....::.|.:     
 Worm   288 ENKLEFKALIDFQTASLSSPGLDVGCLTVTCLSKKDRRTVQSEILDRYYKSFVKSLKTPN----- 347

  Fly   327 PSLQGFQKQFESRRFMCLLAH--LFKPVII 354
             |:...::|.|....:|..|.  |..|.|:
 Worm   348 -SIPYTREQLEDSYELCFPASVILMLPFIL 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 57/318 (18%)
H37A05.2NP_506379.1 DUF1679 3..409 CDD:285194 67/356 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4038
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.