DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and C29F7.2

DIOPT Version :8

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_510235.2 Gene:C29F7.2 / 181463 WormBaseID:WBGene00007811 Length:394 Species:Caenorhabditis elegans

Alignment Length:431 Identity:82/432 (19%)
Similarity:164/432 (38%) Gaps:112/432 (26%)


  Fly     6 LTEEYLQPKLRAYYKDDQLKVVKVWAKPA---------TEKGQNYMSLMTRI------------- 48
            ||:|:|.          ::...|:..||.         :|.|  |||::.::             
 Worm    11 LTKEWLA----------EIIEKKIGVKPKIGTSGILDNSELG--YMSMIRKVQLHFDAEHEESHP 63

  Fly    49 ----HVEIQ-----QGDGLLQNRTYIIKESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNELL 104
                ||.::     :|.|:|.:    ....::|....|.|  |..::|.|.:.|:.......:.|
 Worm    64 NLPKHVVLKIACSSKGTGVLDS----AGADMTETDHSANV--ELFMHNTECNYYKIFAKLTEKPL 122

  Fly   105 QEVGLTGKFTADTIFVDREYRTIIL-----EDLAQYNYVNADRVKQLDLAHTKLTLEVLAKFHAA 164
            ....:.....|:    |:|....::     ||...|:.:.....:||    .|:..|:: |.|..
 Worm   123 HLPVIYAAIKAE----DKEAPVPVIVMEMFEDCKVYDIITGFNEEQL----YKIVDEIV-KLHIF 178

  Fly   165 SIVVKQRHPELLTKSLFIHCFSRDNKGYTEVYEGVLSAFIRFINEQP-------VLKKKYGNK-- 220
            |:..::      .|::....|..:..||   ::.:::.....:.:||       .:|..:...  
 Worm   179 SLTTEE------WKTIVPDAFVLEMAGY---FQTMVAGIGEKLAQQPGLELVSTYIKNTFATDPK 234

  Fly   221 -LQKIHENIMDYGARTFEVGEQELLTLSHGDCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVN 284
             ||.|::..::         |:.:..|:|||.|....|:.    .|...|..||:|.::..||:.
 Worm   235 FLQNINDEYLE---------ERRISVLTHGDLWAPQILWD----KNDDIAGIIDWQITHRGSPME 286

  Fly   285 DLHQFF-TVSLRDEVQDMESVLVEKYYSDLKTNVDTLSYKGI-FPSL-----QGFQKQFESRRFM 342
            |.|... |.:..:..:::...|::.|:..|.:.::.   ||: .|..     :.::..|.:...:
 Worm   287 DFHHIMSTCTSVENRKNLTKPLLDYYFDKLSSGLEA---KGVKMPWTREEIEEEYKYSFINGAAL 348

  Fly   343 CLLAHLF---KPVIIYDG----TEVSSDFSSVYKDTEEGIR 376
            .:.|:.|   .||:..||    ..:...|.......||.|:
 Worm   349 TIFANGFWANSPVLQTDGKPDPVRIGESFKRCKSYLEEVIQ 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 60/323 (19%)
C29F7.2NP_510235.2 CHK 142..321 CDD:214734 40/206 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.