DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56h and Obp83ef

DIOPT Version :9

Sequence 1:NP_001188979.1 Gene:Obp56h / 37271 FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_731042.1 Gene:Obp83ef / 40747 FlyBaseID:FBgn0046876 Length:245 Species:Drosophila melanogaster


Alignment Length:129 Identity:27/129 - (20%)
Similarity:58/129 - (44%) Gaps:23/129 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IALAAFLSMGQCNPDF---RQIMQQCMETNQVTEA---DLKEFMASGMQSSAKENLKCYTKCLME 66
            :.::.||...|...|.   .|.:::|:......|:   ||::.  ....|..:|.:.|..:||..
  Fly     7 VLVSLFLICSQALADLSGDAQTLEKCLRQLSSPESIAGDLRKL--ERYSSWTREEVPCLMRCLAR 69

  Fly    67 KQGHLTNGQFNAQAMLDTLKNVPQIKDKMDEISSGV-NACK-DIK--GTNDCDTAFKVTMCLKE 126
            ::|           ..|..:|..::|...:::.:.| |.|: :::  |::.|..|::...|||:
  Fly    70 EKG-----------WFDVEENKWRLKQLTEDLGADVYNYCRFELRRMGSDGCSFAYRGLRCLKQ 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56hNP_001188979.1 PhBP 26..128 CDD:214783 22/108 (20%)
Obp83efNP_731042.1 PhBP 28..124 CDD:214783 22/108 (20%)
PhBP 133..234 CDD:214783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.