DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Obp56h and Obp83cd

Sequence 1:NP_001188979.1 Gene:Obp56h FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_649612.1 Gene:Obp83cd FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster

Alignment Length:112 Identity:26/113 (23%)
Similarity:48/113 (42%) Gaps:15/113 (13%)


  Fly    15 SMGQCNPDFRQIMQQCMETNQVTEADLKEFMASGMQSSAKENLKCYTKCLMEKQGHLTNGQFNAQ 79
            :|...:|..:..|:.|::  .|.:.:.|.|.|.... ...|.:.|:|:|.::|. |:    |..:
  Fly   138 NMPNISPSAKDAMKDCLQ--DVHQDEWKSFDAFAYY-PVNEPIPCFTRCFVDKL-HI----FEEK 194

  Fly    80 AMLDTLKNVPQ---IKDKMDEISSGVNACKDIKGTNDCDTAFKVTMC 123
            ..|..|:.:.|   |..|    .:.:..|...:|.:.|.|.:|...|
  Fly   195 TRLWKLEAMKQNLGIPAK----GARIRTCHRHRGRDRCATYYKQFTC 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp56hNP_001188979.1 PhBP 26..128 CDD:214783 24/102 (24%)
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783
PhBP 149..242 CDD:214783 24/102 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.