DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56h and Obp83cd

DIOPT Version :10

Sequence 1:NP_611448.2 Gene:Obp56h / 37271 FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster


Alignment Length:112 Identity:26/112 - (23%)
Similarity:48/112 - (42%) Gaps:15/112 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SMGQCNPDFRQIMQQCMETNQVTEADLKEFMASGMQSSAKENLKCYTKCLMEKQGHLTNGQFNAQ 79
            :|...:|..:..|:.|::  .|.:.:.|.|.|.... ...|.:.|:|:|.::|. |:    |..:
  Fly   138 NMPNISPSAKDAMKDCLQ--DVHQDEWKSFDAFAYY-PVNEPIPCFTRCFVDKL-HI----FEEK 194

  Fly    80 AMLDTLKNVPQ---IKDKMDEISSGVNACKDIKGTNDCDTAFKVTMC 123
            ..|..|:.:.|   |..|    .:.:..|...:|.:.|.|.:|...|
  Fly   195 TRLWKLEAMKQNLGIPAK----GARIRTCHRHRGRDRCATYYKQFTC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56hNP_611448.2 PhBP 26..128 CDD:214783 24/101 (24%)
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783
PhBP 149..242 CDD:214783 24/101 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.