DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56h and Obp56g

DIOPT Version :9

Sequence 1:NP_611448.2 Gene:Obp56h / 37271 FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_995903.1 Gene:Obp56g / 37270 FlyBaseID:FBgn0034474 Length:132 Species:Drosophila melanogaster


Alignment Length:126 Identity:36/126 - (28%)
Similarity:67/126 - (53%) Gaps:8/126 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TLFCIALAAFLSMGQCNPD---FRQIMQQCMETNQVTEADLKEFMASGMQS-SAKENLKCYTKCL 64
            ||....|:..|:. |.|.|   .::::..|::.|.||..||.:..:..::: .||:|:||.::|:
  Fly     8 TLLLGCLSGILAQ-QANIDSSVSKELVTDCLKENGVTPQDLADLQSGKVKAEDAKDNVKCSSQCI 71

  Fly    65 MEKQGHLTNGQFNAQAMLDTLKNVPQIKDKMDEISSGVNACKDIKGTNDCDTAFKVTMCLK 125
            :.|.|.:.:   ..:.:.|.:|:.....:..|.|...::.|..:||.|.||||||:..|.:
  Fly    72 LVKSGFMDS---TGKLLTDKIKSYYANSNFKDVIEKDLDRCSAVKGANACDTAFKILSCFQ 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56hNP_611448.2 PhBP 26..128 CDD:214783 29/101 (29%)
Obp56gNP_995903.1 PhBP 32..132 CDD:214783 29/101 (29%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.