DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Obp56h and Obp56g

Sequence 1:NP_001188979.1 Gene:Obp56h FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_995903.1 Gene:Obp56g FlyBaseID:FBgn0034474 Length:132 Species:Drosophila melanogaster

Alignment Length:126 Identity:36/127 (28%)
Similarity:67/127 (53%) Gaps:8/127 (6%)


  Fly     4 TLFCIALAAFLSMGQCNPD---FRQIMQQCMETNQVTEADLKEFMASGMQS-SAKENLKCYTKCL 64
            ||....|:..|:. |.|.|   .::::..|::.|.||..||.:..:..::: .||:|:||.::|:
  Fly     8 TLLLGCLSGILAQ-QANIDSSVSKELVTDCLKENGVTPQDLADLQSGKVKAEDAKDNVKCSSQCI 71

  Fly    65 MEKQGHLTNGQFNAQAMLDTLKNVPQIKDKMDEISSGVNACKDIKGTNDCDTAFKVTMCLK 125
            :.|.|.:.:   ..:.:.|.:|:.....:..|.|...::.|..:||.|.||||||:..|.:
  Fly    72 LVKSGFMDS---TGKLLTDKIKSYYANSNFKDVIEKDLDRCSAVKGANACDTAFKILSCFQ 129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp56hNP_001188979.1 PhBP 26..128 CDD:214783 29/102 (28%)
Obp56gNP_995903.1 PBP_GOBP 30..131 CDD:279703 29/104 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.