DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Obp56h and Obp56a

Sequence 1:NP_001188979.1 Gene:Obp56h FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_611442.1 Gene:Obp56a FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster

Alignment Length:137 Identity:41/138 (30%)
Similarity:65/138 (47%) Gaps:17/138 (12%)


  Fly     6 FCIALAAF---------LSMGQCNPDF-RQIMQQCMETNQVTEADLKEFMASGMQSSAKENLKCY 60
            |.|||:|.         |::.....|. :|..:||.|..::||.:..:..|... ::..||:||:
  Fly     5 FVIALSALFVTLAVGSSLNLSDEQKDLAKQHREQCAEEVKLTEEEKAKVNAKDF-NNPTENIKCF 68

  Fly    61 TKCLMEKQGHLTNGQFNAQAMLDTL-KNVPQIKDKMDEISSGVNACKDIKGTNDCDTAFKVTMCL 124
            ..|..||.|.|.:|:.....:|:.| ..:.:.|.|     :.:..|:.|||.|.||||.|:..|.
  Fly    69 ANCFFEKVGTLKDGELQESVVLEKLGALIGEEKTK-----AALEKCRTIKGENKCDTASKLYDCF 128

  Fly   125 KEHKAIP 131
            :..|..|
  Fly   129 ESFKPAP 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp56hNP_001188979.1 PhBP 26..128 CDD:214783 31/103 (30%)
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:279703 33/110 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2FB6J
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.