DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56h and Obp47a

DIOPT Version :9

Sequence 1:NP_001188979.1 Gene:Obp56h / 37271 FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster


Alignment Length:104 Identity:25/104 - (24%)
Similarity:51/104 - (49%) Gaps:7/104 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QIMQQCMETNQVTEADLKEFMASGMQSSAKENLKCYTKCLMEKQGHLTNGQFNAQAMLDTLKNVP 89
            ::::.|.:...::..:|.:...... |...|:::|:|.||.|:.|.:.:|.|..:.:...|.:|.
  Fly    43 EMIRLCGDQTDISLRELNKLQREDF-SDPSESVQCFTHCLYEQMGLMHDGVFVERDLFGLLSDVS 106

  Fly    90 QIKDKMDEISSGVNACKDIKGTNDCDTAFKVTMCLKEHK 128
            . .|...|     ..|..|:|.|.|:||:::..|.::.|
  Fly   107 N-TDYWPE-----RQCHAIRGNNKCETAYRIHQCQQQLK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56hNP_001188979.1 PhBP 26..128 CDD:214783 24/101 (24%)
Obp47aNP_610632.1 PBP_GOBP 48..132 CDD:279703 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113266at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.