DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56h and Obp19d

DIOPT Version :9

Sequence 1:NP_001188979.1 Gene:Obp56h / 37271 FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_523421.2 Gene:Obp19d / 33040 FlyBaseID:FBgn0011280 Length:150 Species:Drosophila melanogaster


Alignment Length:131 Identity:30/131 - (22%)
Similarity:59/131 - (45%) Gaps:10/131 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFCIALAAFLSMGQCNPDF-RQIMQQCMETNQVTEADLKEFMASGMQSSAKENLKCYTKCLMEK- 67
            :.|:...:.....:.|.|. .::..:|......|:.|:::.|:..:..  :...||...|:|:| 
  Fly    15 ILCLGATSAKPHEEINRDHAAELANECKAETGATDEDVEQLMSHDLPE--RHEAKCLRACVMKKL 77

  Fly    68 QGHLTNGQFNAQAMLDTLKNVPQ-IKDKMDEISSGVNACKDIKGTND-CDTAFKVTMC----LKE 126
            |....:|:.|.:..::.:|.:.: ..:|.|..:..|..|:.|:...| ||.||....|    :||
  Fly    78 QIMDESGKLNKEHAIELVKVMSKHDAEKEDAPAEVVAKCEAIETPEDHCDAAFAYEECIYEQMKE 142

  Fly   127 H 127
            |
  Fly   143 H 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56hNP_001188979.1 PhBP 26..128 CDD:214783 27/109 (25%)
Obp19dNP_523421.2 PBP_GOBP 23..139 CDD:279703 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.