DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Obp56h and Obp19b

Sequence 1:NP_001188979.1 Gene:Obp56h FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_608391.2 Gene:Obp19b FlyBaseID:FBgn0031110 Length:163 Species:Drosophila melanogaster

Alignment Length:145 Identity:33/146 (23%)
Similarity:63/146 (43%) Gaps:29/146 (20%)


  Fly     1 MKFT--LFCIALAAFLSMGQCNPDFRQ---IMQQCME---------TNQVTEADLKEFMASGMQS 51
            :|.|  |..:|.||.| ||....|..:   .:.:.:|         |.:.:..::.|.:.:  :.
  Fly    11 LKMTNLLLAVACAAVL-MGSATADEEEGSMTVDEVVELIEPFGDACTPKPSRENIVEMVLN--KE 72

  Fly    52 SAKENLKCYTKCLMEK-----QGHLTNGQFNAQAMLDTLKNVPQIKDKMDEISSGVNAC-KDIKG 110
            .||...||:..|::|:     :..|   |:|....:|.:..:  ..|:.|:....|..| :::|.
  Fly    73 DAKHETKCFRHCMLEQFELMPEDQL---QYNEDKTVDMINMM--FPDREDDGRRIVKTCNEELKA 132

  Fly   111 TND-CDTAFKVTMCL 124
            ..| |:.|..:.||:
  Fly   133 EQDKCEAAHGIAMCM 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp56hNP_001188979.1 PhBP 26..128 CDD:214783 23/116 (20%)
Obp19bNP_608391.2 PBP_GOBP 38..150 CDD:279703 23/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.