DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Obp56h and Obp57e

Sequence 1:NP_001188979.1 Gene:Obp56h FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_611488.1 Gene:Obp57e FlyBaseID:FBgn0050145 Length:136 Species:Drosophila melanogaster

Alignment Length:100 Identity:20/100 (20%)
Similarity:46/100 (46%) Gaps:16/100 (16%)


  Fly    26 IMQQCMETNQVTEADLKEFMASGMQSSAKENLKCYTKC------LMEKQGHLTNGQFNAQAMLD- 83
            :...|:..|:::|.:..:.|.:..........||:..|      |::::|::...::....::| 
  Fly    24 VFNPCVSQNELSEYEAHQVMENWPVPPIDRAYKCFLTCVLLDLGLIDERGNVQIDKYMKSGVVDW 88

  Fly    84 ---TLKNVP---QIKDKMD--EISSGV-NACKDIK 109
               .::.|.   :..|:.|  |:|.|: |..||:|
  Fly    89 QWVAIELVTCRIEFSDERDLCELSYGIFNCFKDVK 123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp56hNP_001188979.1 PhBP 26..128 CDD:214783 20/100 (20%)
Obp57eNP_611488.1 PhBP 28..123 CDD:214783 19/95 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.