DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Obp56h and Obp57d

Sequence 1:NP_001188979.1 Gene:Obp56h FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_725973.1 Gene:Obp57d FlyBaseID:FBgn0043536 Length:136 Species:Drosophila melanogaster

Alignment Length:99 Identity:21/100 (21%)
Similarity:43/100 (43%) Gaps:19/100 (19%)


  Fly    36 VTEADLKEFMASGMQSSAKENLKCYTKCLME------KQGHLTNGQFNAQAMLDTLKNVPQIKDK 94
            :.|:.|.::.|:...:|.|.:.|||..|:::      ..|.:...::....::|.|...|:|   
  Fly    43 IAESILGDWPANVDLTSVKRSHKCYVTCILQYYNIVTASGEIFLDKYYDTGVIDELAVAPKI--- 104

  Fly    95 MDEISSGVNACK-DIKGTND-CDTAFKVTMCLKE 126
                    |.|: :.:...| |...|.:..||::
  Fly   105 --------NRCRYEFRMETDYCSRIFAIFNCLRQ 130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp56hNP_001188979.1 PhBP 26..128 CDD:214783 21/100 (21%)
Obp57dNP_725973.1 PBP_GOBP <38..131 CDD:279703 21/100 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.