DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Obp56h and Obp56c

Sequence 1:NP_001188979.1 Gene:Obp56h FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_995902.1 Gene:Obp56c FlyBaseID:FBgn0046879 Length:245 Species:Drosophila melanogaster

Alignment Length:182 Identity:34/183 (19%)
Similarity:64/183 (35%) Gaps:60/183 (33%)


  Fly     3 FTLFCIALAAFLSM----------------GQCNPDFRQIMQQCMETNQVTEADLKEFMASGMQS 51
            |.:|.|:....||:                |..|...:::::.||...:::.:.||.|..|.|.|
  Fly    26 FFIFYISFTRSLSVSLNMSMTRTLVPDPPNGTENKLSQEMLRACMRRTEISMSQLKLFHMSLMNS 90

  Fly    52 --------------------------------------SAKENLKCYTKCLMEKQGHLTNGQFNA 78
                                                  ...|.|:|:..||.|.   |...::|.
  Fly    91 DYNNDNDIAPTPVQSIGDVNNLGDLDFNGNSQMPYLDLKHNEPLQCFVSCLYET---LDLDRYNV 152

  Fly    79 QAMLDTLKNVPQIKDKMDEISSGVNACKDIKGTNDCDTAFKVTMCLKEHKAI 130
             .:.:..||  |::..:....:.:..|.|::|...|:.|:|:.:|....|.:
  Fly   153 -LLEEAFKN--QVQTIIQHEKAEIKECSDLQGKTRCEAAYKLHLCYNHLKTL 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp56hNP_001188979.1 PhBP 26..128 CDD:214783 26/140 (19%)
Obp56cNP_995902.1 PBP_GOBP <125..195 CDD:279703 18/76 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.