DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56d and Obp83a

DIOPT Version :10

Sequence 1:NP_611444.2 Gene:Obp56d / 37266 FlyBaseID:FBgn0034470 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster


Alignment Length:93 Identity:25/93 - (26%)
Similarity:46/93 - (49%) Gaps:3/93 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 CAQQEGITKDQAIALRNGNFDDSDPKVKCFANCFLEKIGFL-INGEVQPDVVLAKLGPLAGEDAV 98
            |.::.|:|:.......:|...: |.|:||:.|||..:|..: .||:|..:.:.|.: ||:..|.:
  Fly    75 CVEKTGVTEAAIKEFSDGEIHE-DEKLKCYMNCFFHEIEVVDDNGDVHLEKLFATV-PLSMRDKL 137

  Fly    99 KAVQAKCDATKGADKCDTAYQLFECYYK 126
            ..:...|...:|...|..|:...:|:.|
  Fly   138 MEMSKGCVHPEGDTLCHKAWWFHQCWKK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56dNP_611444.2 PBP_GOBP 19..127 CDD:460193 25/93 (27%)
Obp83aNP_001287190.1 PhBP 71..167 CDD:214783 25/93 (27%)

Return to query results.
Submit another query.