DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: isopeptidase-T-3 and ubac1

Sequence 1:NP_001261098.1 Gene:isopeptidase-T-3 FlyBaseID:FBgn0028372 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_021331997.1 Gene:ubac1 ZFINID:ZDB-GENE-030131-9372 Length:416 Species:Danio rerio

Alignment Length:344 Identity:98/345 (28%)
Similarity:166/345 (48%) Gaps:40/345 (12%)


  Fly   228 LNEGDTLAQLKVRNNETFIL--------SPRRNTLPQTVSRIREVPGPNEQLVESATRYVPVNCN 284
            |.|..|:::..:::.:..||        .|:...:.....:.::...|::..:..||.       
Zfish    72 LTESKTVSEENLKDKDCLILLKKRPPPAPPKMTDISSEEKKKQDNKAPDKDAILKATA------- 129

  Fly   285 QLPTIDINEIFQQSNI---QYDVRKVLISLAQASAAVIGAGPYAPRLI----AMLKQRLINRRNQ 342
            .|.|.:.:....|.||   |.::||:|:||.:.:..::...|.|..|.    |||.:...:|.::
Zfish   130 SLSTRNTDRTVTQHNIRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEEDRVDE 194

  Fly   343 QADTLQCLVDMGFKRELAAFALKAHNGIYSTTMEWLIQNQNEENPQEP-PGMNMQHSLSSISP-- 404
            .|  ||.|.:|||....|..||:.::...:..|||||::.::.....| ||.....:.::.:|  
Zfish   195 TA--LQQLTEMGFPESRAVKALRLNHMSVTQAMEWLIEHVDDPMVDAPLPGQESPGAAAAAAPAP 257

  Fly   405 ---STIVTNNETIENTAALIE---------IVRIYSHRD-SPPSDEIVESLTEMGFEETAVLAAL 456
               :|.:.....:.:.|::.|         ..||...|: .|.|.:.|.:|.||||:|..|:.||
Zfish   258 GASATALAARARLISQASIDEAKQDELTEIFKRIRRKREFRPDSRQAVIALMEMGFDEKEVIDAL 322

  Fly   457 KKTGNNKASACEWLCDNRSGSVIELREGLAPDSPILKVILEMPQVQMTLSNPKTFLAFLGILENE 521
            :...|.:.:|||||..:|..|..:|.:|:..:||:.:.|||.|.||:.|:||||.|||..:|||.
Zfish   323 RVNNNQQDAACEWLLGDRKPSPEDLDKGIDTNSPLFQAILENPVVQLGLTNPKTLLAFEDMLENP 387

  Fly   522 HAIRVWRGDNDTTSVITHI 540
            .....|..|.:|..|:..|
Zfish   388 LNSTQWMNDPETGPVMLQI 406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
isopeptidase-T-3NP_001261098.1 UBA_like_SF 345..384 CDD:304366 14/39 (36%)
UBA2_KPC2 434..472 CDD:270489 17/38 (45%)
ubac1XP_021331997.1 UBQ 14..90 CDD:320785 3/18 (17%)
Peptidase_C19 <195..346 CDD:321984 45/153 (29%)
UBA1_KPC2 195..231 CDD:270488 15/38 (39%)
UBA2_KPC2 301..338 CDD:270489 17/37 (46%)
STI1 364..403 CDD:128966 18/39 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IDF
Hieranoid 1 1.000
Homologene 1 1.000 H9409
Inparanoid 1 1.050 123 1.000 Inparanoid score I4633
OMA 1 1.010
OrthoDB 1 1.010 D1163759at2759
OrthoFinder 1 1.000 FOG0007208
OrthoInspector 1 1.000 T1051584
orthoMCL 1 0.900 OOG5_135010
Panther 1 1.100 LDO PTHR46738
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4908
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.