DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: isopeptidase-T-3 and ubac1

Sequence 1:NP_001261098.1 Gene:isopeptidase-T-3 FlyBaseID:FBgn0028372 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_001016826.1 Gene:ubac1 XenbaseID:XB-GENE-997434 Length:406 Species:Xenopus tropicalis

Alignment Length:409 Identity:112/410 (27%)
Similarity:182/410 (44%) Gaps:67/410 (16%)


  Fly   172 RVLIFKTDVNKRLNELKSEVILE-------------LSDDPDSIQLFAPDVRHLNPRYRLYRAEY 223
            |:.|...|..:.|.|:..|:.:|             ..:||.|:           ..::|..|  
 Frog    15 RLHICSLDGAEWLEEVTEEITVEKLKEKCLKHCSHGSLEDPKSL-----------THHKLVHA-- 66

  Fly   224 FGGE--LNEGDTLAQLKVRNNETFILSPRRNTLPQTVSRIREV----------PGPNEQLVESAT 276
             ..|  |::..|||:..:::|:..:|..:|  .|....::.||          ..|::..:..||
 Frog    67 -SSERVLSDTKTLAEENLQDNDVLLLVKKR--APPPTPKMAEVSADEKRKQDQKAPDKDAILKAT 128

  Fly   277 RYVPVNCNQLPTIDINEIFQQSNIQYDVRKVLISLAQASAAVIGAGPYAPRLI----AMLKQRLI 337
            ..:|...........|    ..:.|.::||:|:||.:.:..::...|.|..|.    |||.:...
 Frog   129 AGLPARSTDRTVAQHN----MRDFQTELRKILVSLIEVAQKLLALNPDAIELFKKANAMLDEDDE 189

  Fly   338 NRRNQQADTLQCLVDMGFKRELAAFALKAHNGIYSTTMEWLIQNQNE---------ENPQEPPGM 393
            :|.::.|  |:.|.:|||....|..||:.::...:..|||||::.::         ||..|..| 
 Frog   190 DRVDEVA--LRQLTEMGFPESRAVKALRLNHMSVTQAMEWLIEHADDPAADAPLPCENSSEAAG- 251

  Fly   394 NMQHSLSSISPSTIVTNNETIENTA-ALIEIV-RIYSHRDSPPSDEIVESLTEMGFEETAVLAAL 456
                .|::....|..|.....|:.. .|.||. :|...|:..|....|.:|.||||:|..|:.||
 Frog   252 ----GLATGEAETKPTLGAGAEDPKDELTEIFKKIRRKREFRPDPRAVIALMEMGFDEKEVIDAL 312

  Fly   457 KKTGNNKASACEWLCDNRSGSVIELREGLAPDSPILKVILEMPQVQMTLSNPKTFLAFLGILENE 521
            :...|.:.:|||||..:|..|..:|.:|:...||:.:.||:.|.||:.|:||||.|||..:|||.
 Frog   313 RVNNNQQDAACEWLLGDRKPSPEDLDKGIDTTSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENP 377

  Fly   522 HAIRVWRGDNDTTSVITHI 540
            .....|..|.:|..|:..|
 Frog   378 LNSTQWMNDPETGPVMLQI 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
isopeptidase-T-3NP_001261098.1 UBA_like_SF 345..384 CDD:304366 13/39 (33%)
UBA2_KPC2 434..472 CDD:270489 17/38 (45%)
ubac1NP_001016826.1 UBA1_KPC2 196..232 CDD:270488 14/38 (37%)
UBA2_KPC2 290..328 CDD:270489 17/38 (45%)
STI1 354..393 CDD:128966 18/39 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IDF
Hieranoid 1 1.000
Homologene 1 1.000 H9409
Inparanoid 1 1.050 119 1.000 Inparanoid score I4517
OMA 1 1.010
OrthoDB 1 1.010 D1163759at2759
OrthoFinder 1 1.000 FOG0007208
OrthoInspector 1 1.000 T600259
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4908
TreeFam 1 0.960
1110.870

Return to query results.
Submit another query.