DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: isopeptidase-T-3 and Ubac1

Sequence 1:NP_001261098.1 Gene:isopeptidase-T-3 FlyBaseID:FBgn0028372 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_001007743.1 Gene:Ubac1 RGDID:1359542 Length:409 Species:Rattus norvegicus

Alignment Length:334 Identity:94/335 (28%)
Similarity:159/335 (47%) Gaps:27/335 (8%)


  Fly   228 LNEGDTLAQLKVRNNETFILSPRRNTLPQTVSRIREV----------PGPNEQLVESATRYVPVN 282
            |::..|:.:..:::.:..:|..:|  .|..:.::.:|          ..|::..:..||..:|..
  Rat    72 LSDSKTILEENIQDQDVLLLIKKR--APSPIPKMADVSAEEKKKQEQKAPDKDAILRATANLPAC 134

  Fly   283 CNQLPTIDINEIFQQSNIQYDVRKVLISLAQASAAVIGAGPYAPRLIAMLKQRLINRRNQQAD-- 345
            ......:...    ..:.|.::||:|:||.:.:..::...|.|..|.......|....:::.|  
  Rat   135 STDRTAVQTT----MRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEDERVDET 195

  Fly   346 TLQCLVDMGFKRELAAFALKAHNGIYSTTMEWLIQNQNEENPQEP-PGMNMQ-------HSLSSI 402
            .|:.|.:|||....|:.||:.::......|||||::..:.....| ||...|       .:.||.
  Rat   196 ALRQLTEMGFPESRASKALRLNHMSVPQAMEWLIEHSEDPAIDTPLPGHAAQAEASAAAATSSSS 260

  Fly   403 SPSTIVTNNETIENTAALIEIV-RIYSHRDSPPSDEIVESLTEMGFEETAVLAALKKTGNNKASA 466
            |.:.:.|:.|..|:...|.||. :|...::.......|.||.||||:|..|:.||:...|.:.:|
  Rat   261 SEAAVGTSVEDEESRDELTEIFKKIRRKKEFRADARAVISLMEMGFDEKEVIDALRVNNNQQNAA 325

  Fly   467 CEWLCDNRSGSVIELREGLAPDSPILKVILEMPQVQMTLSNPKTFLAFLGILENEHAIRVWRGDN 531
            ||||..:|..|..||.:|:.|:||:.:.||:.|.||:.|:||||.|||..:|||......|..|.
  Rat   326 CEWLLGDRKPSPEELDQGIDPNSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDP 390

  Fly   532 DTTSVITHI 540
            :|..|:..|
  Rat   391 ETGPVMLQI 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
isopeptidase-T-3NP_001261098.1 UBA_like_SF 345..384 CDD:304366 14/41 (34%)
UBA2_KPC2 434..472 CDD:270489 17/38 (45%)
Ubac1NP_001007743.1 UBA1_KPC2 195..232 CDD:270488 13/37 (35%)
UBA2_KPC2 294..331 CDD:270489 17/37 (46%)
STI1 357..396 CDD:128966 18/39 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IDF
Hieranoid 1 1.000
Homologene 1 1.000 H9409
Inparanoid 1 1.050 126 1.000 Inparanoid score I4523
OMA 1 1.010
OrthoDB 1 1.010 D1163759at2759
OrthoFinder 1 1.000 FOG0007208
OrthoInspector 1 1.000 T1085775
orthoMCL 1 0.900 OOG5_135010
Panther 1 1.100 LDO PTHR46738
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.840

Return to query results.
Submit another query.