DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: isopeptidase-T-3 and UBAC1

Sequence 1:NP_001261098.1 Gene:isopeptidase-T-3 FlyBaseID:FBgn0028372 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_057256.2 Gene:UBAC1 HGNCID:30221 Length:405 Species:Homo sapiens

Alignment Length:368 Identity:100/369 (27%)
Similarity:172/369 (47%) Gaps:49/369 (13%)


  Fly   197 DDPDSIQLFAPDVRHLNPRYRLYRAEYFGGE--LNEGDTLAQLKVRNNETFILSPRR--NTLPQT 257
            :||.||           ..::|..|   ..|  |::..|:.:..:::.:..:|..:|  :.||:.
Human    53 EDPKSI-----------THHKLIHA---ASERVLSDARTILEENIQDQDVLLLIKKRAPSPLPKM 103

  Fly   258 V------SRIREVPGPNEQLVESATRYVPVNCNQLPTIDINEIFQQSNI---QYDVRKVLISLAQ 313
            .      .:.::...|:::.:..||.       .||:.:::....|:|:   |.::||:|:||.:
Human   104 ADVSAEEKKKQDQKAPDKEAILRATA-------NLPSYNMDRAAVQTNMRDFQTELRKILVSLIE 161

  Fly   314 ASAAVIGAGPYAPRLIAMLKQRLINRRNQQAD--TLQCLVDMGFKRELAAFALKAHNGIYSTTME 376
            .:..::...|.|..|.......|....:::.|  .|:.|.:|||....|..||:.::......||
Human   162 VAQKLLALNPDAVELFKKANAMLDEDEDERVDEAALRQLTEMGFPENRATKALQLNHMSVPQAME 226

  Fly   377 WLIQNQNE---------ENPQEPPGMNMQHSLSSISPSTIVTNNETIENTAALIEIVRIYSHRDS 432
            |||::..:         :.|.|..|.....|.::...|  .|:.|..:....:.:.:|  ..|:.
Human   227 WLIEHAEDPTIDTPLPGQAPPEAEGATAAASEAAAGAS--ATDEEARDELTEIFKKIR--RKREF 287

  Fly   433 PPSDEIVESLTEMGFEETAVLAALKKTGNNKASACEWLCDNRSGSVIELREGLAPDSPILKVILE 497
            ......|.||.||||:|..|:.||:...|.:.:|||||..:|..|..||.:|:.||||:.:.||:
Human   288 RADARAVISLMEMGFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELDKGIDPDSPLFQAILD 352

  Fly   498 MPQVQMTLSNPKTFLAFLGILENEHAIRVWRGDNDTTSVITHI 540
            .|.||:.|:||||.|||..:|||......|..|.:|..|:..|
Human   353 NPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQI 395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
isopeptidase-T-3NP_001261098.1 UBA_like_SF 345..384 CDD:304366 14/41 (34%)
UBA2_KPC2 434..472 CDD:270489 17/38 (45%)
UBAC1NP_057256.2 UBA1_KPC2 195..232 CDD:270488 13/37 (35%)
UBA2_KPC2 290..327 CDD:270489 17/37 (46%)
STI1 353..392 CDD:128966 18/39 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28IDF
Hieranoid 1 1.000
Homologene 1 1.000 H9409
Inparanoid 1 1.050 128 1.000 Inparanoid score I4606
Isobase 1 0.950 0 Normalized mean entropy S7838
OMA 1 1.010
OrthoDB 1 1.010 D1163759at2759
OrthoFinder 1 1.000 FOG0007208
OrthoInspector 1 1.000 T1072120
orthoMCL 1 0.900 OOG5_135010
Panther 1 1.100 LDO PTHR46738
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4908
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.