DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir7e

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster


Alignment Length:461 Identity:95/461 - (20%)
Similarity:167/461 - (36%) Gaps:115/461 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLDTDLASGVIRSPYS-------FDIPHAFIFNETQFVVPKFCGPYM-EIVKHFAEVYHYQLFL 57
            ||::.||....:|:.:.       :|:|.....:|.|..|.:..|.|. .::...||..::.:.:
  Fly   193 MLVEPDLFPRKLRNFFGCPLRCALWDVPPFLTLDEDQEEVLRVNGGYEGRLLLALAEKMNFTIAV 257

  Fly    58 ---------DSLESLPKKSV------VEQDIISGKYNLSLHGVIIRPEETSDFFNATQHSYPLEL 107
                     ::||.|.:..|      :.|.:..|....|.|..    .:|.:.|.....||    
  Fly   258 RKVHVNMRDEALEMLRRDEVDLTLGGIRQTVARGMVATSSHNY----HQTREVFGVLASSY---- 314

  Fly   108 MTNCVMVPLAPELPKWMYMVWPLGKYIWTCLFLGTFYVALLLRYVHWREPGNATRSYTRNVLHAM 172
                       ||..:..:.:|....||..: ||...::.|::.:    .|...|....:.....
  Fly   315 -----------ELSSFDILFYPYRLQIWMGI-LGVVALSALIQLI----VGRMLRERMGSRFWLN 363

  Fly   173 ALLMFSANMNMSVKLKHAS---IRVIIFYTLLY--IFGFILTNYHLSHMTAFDMKP--------- 223
            ..|:|.....:.....|.:   ..:::.|||:.  |:..:|  |||......:..|         
  Fly   364 LELVFVGMPLLECPRSHTARLYCVMLMMYTLIIRTIYQGLL--YHLIRTHQLNRWPQTIESLVQK 426

  Fly   224 ---VFLRPI-----DTWSDLIHSRLRIVIHDSLLEELRWLPVYQALLASPSRSYAYVVTQDAWLF 280
               |.|.||     |....:.|.|.|::..:|.|:.|.:|.....|     |.:......|.::.
  Fly   427 NFTVVLTPIVQEVLDEIPSVQHMRFRLLEANSELDPLYFLEANHQL-----RQHVTASALDIFIH 486

  Fly   281 FNR--QQKVLIQPYFHLSKVCFGGLFNALP-----------MASNASFADSLNKFILNVWQAGL- 331
            |||  ..||     ....:...|..|..:|           :|.::...|.||:.|:.:...|| 
  Fly   487 FNRLSADKV-----HQRGEQGSGAHFEIVPEDIISMQLTMYLAKHSFLIDQLNEEIMWMRSVGLL 546

  Fly   332 --WNYWEELAFRYA--EQAGYAKVFLDTYPVEPLNLEFFTTAWIVLSAGIPISSLAFCLELF--- 389
              |:.| ||:..|.  ||:......::.|.:           ::::..|:.:..|.|.|||.   
  Fly   547 SVWSRW-ELSESYLRNEQSFQVLGTMELYAI-----------FLMVLVGLIVGLLVFILELVSMR 599

  Fly   390 -IHRRK 394
             |:.||
  Fly   600 SIYLRK 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir56bNP_611430.1 None
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 19/98 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.