DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir67b

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_648393.1 Gene:Ir67b / 39194 FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster


Alignment Length:422 Identity:89/422 - (21%)
Similarity:180/422 - (42%) Gaps:79/422 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DLASGVIRSPYSFDIPHAFIFNETQ--FVVPKFCGPYMEIVKHFAEVYHYQLFL-------DSLE 61
            ::.||::.:    ..|..|.|.:.|  .::   .|..:.::..|...::..:.|       |.||
  Fly   179 NITSGLVIA----GAPRWFSFRDRQNRLIL---TGYMLRMIVDFTNHFNGSVRLMNVLTVNDGLE 236

  Fly    62 SLPKKSVVEQDIISGKYNLSLHGVIIRPEETSDFFNATQHSYPLELMTNC-VMVPLAPELPKWMY 125
            .|..:::            .....:|||.::....|       :..:.|| ::||.:..||.|:|
  Fly   237 LLANRTI------------DFFPFLIRPLKSFSMSN-------ILYLENCGLIVPTSRPLPNWVY 282

  Fly   126 MVWPLGKYIWTCLFLGTFYVALLLRYVHWREPGNATRSYTRNVLHAMALLMF-SANMNMSVKLKH 189
            ::.|.....|....:...|.:|.||.:     .....|.:...|..:.|:|: |.:.:|..:   
  Fly   283 LLRPYAFDTWIAWLIMLIYCSLALRIL-----SKGQISISAAFLKVLRLVMYLSGSRDMGTR--- 339

  Fly   190 ASIRVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHS------------RLRI 242
            .:.|.:..:.:|...||||||.:::.:::.....::.:.|:||.||..|            .:..
  Fly   340 PTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWEDLDKSDSIWPLIDVDIKTMEK 404

  Fly   243 VIHD--SLLEELRWLPVYQALLASPSRSYAYVVTQDAWLFFNR------QQKVLIQPYFHLSKVC 299
            :|.|  .||:::  :|..:|.:.:..|:.........  ||:|      |||.|..|.|..    
  Fly   405 LIPDRTKLLKKI--VPTLEADVDTYRRNLNTSCIHSG--FFDRIDFALYQQKFLRFPIFRK---- 461

  Fly   300 FGGLFNALPMASNASFA----DSLNKFILNVWQAGLWNYWEELAFRYAEQAGYAKV-FLDTY-PV 358
            |..|....|:..:|:|.    ...|.|:..::::|::...::.|:|:..|:|...: |.|.: .|
  Fly   462 FPHLLYQQPLQISAAFGRPYLQLFNWFVRKIFESGIYLKMKDDAYRHGIQSGLLNLAFRDRHLEV 526

  Fly   359 EPLNLEFFTTAWIVLSAGIPISSLAFCLELFI 390
            :..::|::.....:...|:.::::.|.|||.|
  Fly   527 KSNDVEYYYLIAGLWFGGLTLATVCFLLELLI 558



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.