DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir60a

DIOPT Version :8

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_611901.1 Gene:Ir60a / 37881 FlyBaseID:FBgn0034994 Length:716 Species:Drosophila melanogaster

Alignment Length:463 Identity:90/464 (19%)
Similarity:154/464 (33%) Gaps:163/464 (35%)


  Fly    24 FIFNETQFVVPKFCGPYMEIVKHFAEVYHYQLFLDSLES-------------LPKKSVVEQDIIS 75
            |:.|..:|.|.:.|                     ||||             |.|....|.|.:.
  Fly   297 FMKNRLKFDVNQTC---------------------SLESRGEMDGPANWTGLLGKVQNNECDFVF 340

  Fly    76 GKYNLSLHGVIIRPE-ETSDFFNATQ------HSYPLELMTNCVMVPLAPELPKWMYMVWPLGKY 133
            |.|         .|: |.:|.|..:.      |::         .:.:|...|.|..:|.....|
  Fly   341 GGY---------YPDNEVADHFWGSDTYLQDAHTW---------YIKMADRRPAWQALVGIFEAY 387

  Fly   134 IWTCLFLGTFYVALLLRYVHW-------REPGNATRSYTRNVLHAMALLMFSANMNMSVKLKHAS 191
            .|    :| |.:.|::.::.|       .||    :.|.:  |...|:...:..::::|:.:...
  Fly   388 TW----IG-FILILIISWLFWFTLVMILPEP----KYYQQ--LSLTAINALAVTISIAVQERPIC 441

  Fly   192 IRVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRLRIVIHDSLLEELRWLP 256
            ....:|:..|.::|..:...:.|.|.|....|.:|..:|..::::.:.:....|:   |...|  
  Fly   442 ETTRLFFMALTLYGLNVVATYTSKMIATFQDPGYLHQLDELTEVVAAGIPFGGHE---ESRDW-- 501

  Fly   257 VYQALLASPSRSYAYVVTQDAWLF--FNRQQKVLIQPYF-----HLSKVCFGG---LFNALPMAS 311
                          :....|.|:|  :|      |.|.|     :|..|.:|.   |.|.: ...
  Fly   502 --------------FENDDDMWIFNGYN------ISPEFIPQSKNLEAVKWGQRCILSNRM-YTM 545

  Fly   312 NASFADSLNKFILNVW--------QAGLWNYWE-ELAFRYAEQAG-YAKVFLD-----TY----- 356
            .:..||.:..|..||:        :||....:| ....|.....| :.|:..|     ||     
  Fly   546 QSPLADVIYAFPNNVFSSPVQMIMKAGFPFLFEMNSIIRLMRDVGIFQKIDADFRYNNTYLNRIN 610

  Fly   357 ---PVEP-----LNLEFFTTAWIVLSAGIPISSLAFCLELFIH---------------------- 391
               |..|     |..|.....:.:|..|...::|.|..||.||                      
  Fly   611 KMRPQFPETAIVLTTEHLKGPFFILVVGSCWAALTFIGELIIHRWRTQLVSTSEQQDRRSDKRRR 675

  Fly   392 RRKQRRPQ 399
            ||::|:|:
  Fly   676 RRRRRKPE 683



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.