DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir40a

DIOPT Version :8

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster

Alignment Length:516 Identity:102/517 (20%)
Similarity:178/517 (34%) Gaps:157/517 (30%)


  Fly    26 FNETQFVVPKFCGPYMEIVKHFAEVYHYQLFLDSLESLPKKSVVEQDIISGKYN-----LSLH-- 83
            |....|.||.|..|....|.:....:......:||:|:.|:.|   .:..|:.:     ||.|  
  Fly   213 FKGRTFRVPVFHSPPWFWVTYCNNSFEEDEEFNSLDSIEKRKV---RVTGGRDHRLLMLLSKHMN 274

  Fly    84 ------------------------------GVIIRPEETSDFF-----------NATQHSYPLEL 107
                                          |:.:.....:|||           .|.:.|: ..|
  Fly   275 FRFKYIEAPGRTQGSMRSEDGKDSNDSFTGGIGLLQSGQADFFLGDVGLSWERRKAIEFSF-FTL 338

  Fly   108 MTNCVMVPLAP-ELPKWMYMVWPLGKYIW-----TCLFLG-TFYVALLLRYVHWREPGNATRSY- 164
            ..:......|| .|.:.:.::.|..:.||     |.:|.| .||..:.|.|:..|...|:...: 
  Fly   339 ADSGAFATHAPRRLNEALAIMRPFKQDIWPHLILTIIFSGPIFYGIIALPYIWRRRWANSDVEHL 403

  Fly   165 ---------------------TRNVL--HAMALLMFSANMNMSVKL--------KHASIRVIIFY 198
                                 .|.||  |.|...:|...:..:::|        .|...|. .|.
  Fly   404 GELYIHMTYLKEITPRLLKLKPRTVLSAHQMPHQLFQKCIWFTLRLFLKQSCNELHNGYRA-KFL 467

  Fly   199 TLLYIFG--FILTNYHLSHMTAFDMKPVFLRPIDTWSDL----IHSRLRIVI--HDSLLEELR-- 253
            |::|...  ::|.:.:.:.:|:...:|....||:|...|    ||...|:.:  ..|.||.|.  
  Fly   468 TIVYWIAATYVLADVYSAQLTSQFARPAREPPINTLQRLQAAMIHDGYRLYVEKESSSLEMLENG 532

  Fly   254 ----------------------WLPVYQA---LLASPSRSYAYVVTQDAWLFFNRQQKVLIQPY- 292
                                  ::...:|   |:|......|.:..::. ||||      :|.| 
  Fly   533 TELFRQLYALMRQQVINDPQGFFIDSVEAGIKLIAEGGEDKAVLGGRET-LFFN------VQQYG 590

  Fly   293 ---FHLSKVCFGGLFNALPMASNASFADSLNKFILNVWQAGLWNYW--EELAFRYAE-------- 344
               |.||:..: ..::|:.:.....|..|||..::.::::|:.:..  .|.|.:|.|        
  Fly   591 SNNFQLSQKLY-TRYSAVAVQIGCPFLGSLNNVLMQLFESGILDKMTAAEYAKQYQEVEATRIYK 654

  Fly   345 ---QAGYAKVF-----LDTYPVEPLNLEFFTTAWIVLSAGIPISSLAFCLELFIHRRKQRR 397
               ||..::.:     .|:..:.||||.....|:|.|..|...:.:...||:...:..|.|
  Fly   655 GSVQAKNSEAYSRTESYDSTVISPLNLRMLQGAFIALGVGSLAAGVILLLEIVFIKLDQAR 715

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir56bNP_611430.1 None
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 21/126 (17%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 20/95 (21%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 30/149 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.