DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir7g

DIOPT Version :8

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_572413.2 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:561 Species:Drosophila melanogaster

Alignment Length:305 Identity:62/306 (20%)
Similarity:106/306 (35%) Gaps:118/306 (39%)


  Fly   134 IWTCLFLGTFYVALLLRYVHWREPGNATRSYTRNVLHAMALLMFSANMNMSVKLKHASIRVIIFY 198
            ||:..|....::.||| :..|...|...||            |:||               ::|:
  Fly   327 IWSFPFQALTWICLLL-FASWLIFGLIVRS------------MYSA---------------LLFF 363

  Fly   199 TLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRLRIVIHDSLLEELRWLPVYQALLA 263
            .|         .|||......:::           ||.|.....|:..:.|::||.:|..|.||.
  Fly   364 IL---------RYHLHQRLPGNLQ-----------DLTHGDYAAVMGRTTLQDLREVPSLQDLLG 408

  Fly   264 SPSRSYAYVVTQDAWLFFNRQQKVL-------------IQPYF----------HLSKVCF-GGLF 304
            ..|    .:||.:      |:::||             ..|.|          ||::... .|.:
  Fly   409 LKS----VIVTSE------REEEVLRTLDRCTLREGAGSHPLFFGLISQDALLHLTQRGHRAGAY 463

  Fly   305 NALP-----------MASNASFADSLNKFILNVWQAGLWNYWEELAFRYAEQAGYAKVFL----- 353
            :.:|           :..::..|..|:..::::...||.::|   |.:.|.:..:...||     
  Fly   464 HIIPQDVLEQQLAIYLQKHSHLASHLDHLVMSIRSVGLVHHW---AGQMASERYFRSRFLYREKR 525

  Fly   354 ----DTYPVEPLNLEFFTTAWIVLSAGIPISSL-AFCLELFIHRR 393
                |.:.|            .:|:||:.:.|| .|..||...||
  Fly   526 IRQPDLWAV------------YILTAGLYLLSLVVFICELLASRR 558



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.