DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir7c

DIOPT Version :8

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001245572.1 Gene:Ir7c / 31692 FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster

Alignment Length:382 Identity:74/383 (19%)
Similarity:140/383 (37%) Gaps:110/383 (29%)


  Fly    73 IISGKYNLSLHGVIIRPEETSDFFNATQH-SYPLELMTNCVMVPLAPELPKWMYMVWPLGKYIWT 136
            ::.|:.||:....:.....:.....:|.: |:|:.|     :||....:.....:..|....||:
  Fly   286 MVDGEVNLTFVCFMYSKARSDLMLPSTSYTSFPIVL-----VVPSGGSISPMGRLTRPFRYIIWS 345

  Fly   137 CLFLGT---FYVALLLRYVHWREPGNATRSYT---RNVLHAM--------ALLMFSANMNMSVKL 187
            |:.:..   |.:..||:..  ..||  .|:..   ||.|..|        .|.:::...|.:   
  Fly   346 CILVSLIFGFVLICLLKIT--ALPG--LRNLVLGRRNRLPFMGMWASLLGGLALYNPQRNFA--- 403

  Fly   188 KHASIRVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLR-PIDTWSDLIHSRLRIVIHDSLLEE 251
                 |.|:...||..  .||...:...:... ::.|.:| ||.:.|:::....          |
  Fly   404 -----RYILVMWLLQT--LILRAAYTGQLYLL-LQDVEMRSPIKSLSEVLAKDY----------E 450

  Fly   252 LRWLPVYQALL--ASPSRSYAYVVTQDAWLFFNRQQK------VLIQPYF------------HLS 296
            .|.||..:.:.  :.|:.::..|::.:..|:..|.:.      .|:||..            ||:
  Fly   451 FRILPALRTIFKDSMPTTNFHAVLSLEESLYRLRDEDDPGITVALLQPTVNQFDFRSGPNKRHLT 515

  Fly   297 KVCFGGLFNALP-----------MASNASFADSLNKFILNVWQAGLWNYWEELAFRYAEQAGYAK 350
                     .||           |..::.|...:::.|:.:..:|:             .|.|.|
  Fly   516 ---------VLPDPLMTAPLTFYMRPHSYFKRRIDRLIMAMMSSGI-------------VARYRK 558

  Fly   351 VFLDTYP-------VEPLNLEFFTTAWI-VLSAGIPISSL-AFCLELFI--HRRKQR 396
            :::|...       :||..|..:..:.| |..||:.:.:| .|.||:..  |||.:|
  Fly   559 MYMDRIKRVSKRRNLEPKPLSIWRLSGIFVCCAGLYLVALIVFILEILTTNHRRLRR 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir56bNP_611430.1 None
Ir7cNP_001245572.1 Lig_chan-Glu_bd 225..287 CDD:214911 0/1 (0%)
Lig_chan 343..593 CDD:278489 56/297 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.