DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11007 and C35D10.10

Sequence 1:NP_001286617.1 Gene:CG11007 FlyBaseID:FBgn0034455 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_498012.1 Gene:C35D10.10 WormBaseID:WBGene00016446 Length:265 Species:Caenorhabditis elegans

Alignment Length:252 Identity:101/253 (40%)
Similarity:162/253 (64%) Gaps:7/253 (3%)


  Fly     8 ALLAKPYYWVNILLAISYLLAKKTQFICTRLFILAGEDEACDLDSREVEILFFLLIVVMIRSRKT 72
            ||.|  :::.|.|||:::.:.:.|. :|..:|.:.| :|.|::||||.|||.||||::..:.|| 
 Worm    12 ALTA--FHFFNTLLALAFPVIRSTS-LCDYVFAVEG-NEQCEIDSREREILMFLLIILAWKGRK- 71

  Fly    73 GSVTMINYLASSFLYTKVANAILWAYADFRYGLGFLLLCVLVGMVLPEPSYRGPEHITYFRNAQV 137
             :...::|:.:.||::|:|...|:..||...|:.::|.|::|.::.|||.|.|||.:|||:..|:
 Worm    72 -ATNWMHYVNNIFLFSKIAGMFLFIRADILPGIIYILACLIVTVLFPEPVYNGPEQVTYFQGEQL 135

  Fly   138 FEEELARDKRTSWLICFYTVWNPSCVNFAPVFAELSAEYNTDHLKFGKIDIGRFPDVAQKYRISD 202
            | |||.|::.|.|:|.|:|.|:|.|.:.:|||||||.::...::||||:||||:....:::|::.
 Worm   136 F-EELTRNRNTIWVIQFFTTWSPECRHTSPVFAELSQKFTLPNMKFGKLDIGRWAKEGERFRVNA 199

  Fly   203 SSFSRQLPTVILFQQGKETDRRPCVDSKGKLQKFFFSSDNVRATFGLNQLYKEAIER 259
            ...||||||:.:|:..||..|||.|:...:...|.||.:|....|.|..||.|..|:
 Worm   200 HPMSRQLPTICVFKDAKEIARRPLVNDSRRAVPFVFSEENCVLAFDLLNLYNEQKEK 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11007NP_001286617.1 TMX2 100..251 CDD:239260 64/151 (42%)
C35D10.10NP_498012.1 TMX2 98..248 CDD:239260 64/151 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C236489728
eggNOG 1 0.900 E1_KOG0914
Hieranoid 1 1.000
Homologene 1 1.000 H9317
Inparanoid 1 1.050 197 1.000 Inparanoid score I2468
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1107509at2759
OrthoFinder 1 1.000 FOG0005343
OrthoInspector 1 1.000 T476670
orthoMCL 1 0.900 OOG5_131623
Panther 1 1.100 LDO PTHR15853
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2853
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.