DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rep and gdi2

Sequence 1:NP_477420.1 Gene:Rep FlyBaseID:FBgn0026378 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001005676.1 Gene:gdi2 XenbaseID:XB-GENE-980621 Length:446 Species:Xenopus tropicalis

Alignment Length:519 Identity:123/520 (24%)
Similarity:221/520 (43%) Gaps:121/520 (23%)


  Fly     7 EQFDLVVIGTGFTESCIAAAGSRIGKSVLHLDSNEYYGDVWSSFS-MDALCARLDQEVEPHSALR 70
            |::|::|:|||.||..::...|..||.|||:|.|.|||...:|.: ::.|..|.:....|...:.
 Frog     3 EEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNSYYGGESASITPLEDLYKRFNIPGSPPECMG 67

  Fly    71 NARYTWHSMEKESETDAQSWNRDSVLAKSRRFSLDLCPRILYAAGELVQLLIKSNICRYAEFRAV 135
            ..|               .||            :||.|:.|.|.|:||::|:.:.:.||.:|:.:
 Frog    68 RGR---------------DWN------------VDLIPKFLMANGQLVKMLLFTEVTRYLDFKVI 105

  Fly   136 DHVCMRHNGEIVSVPCSRSDVFNTKTLTIVEKRLLMKFLTACNDYGED-----KC---------- 185
            :...:...|:|..||.:.::...:..:.:.|||...|||:...::.|:     :|          
 Frog   106 EGSFVYKGGKIYKVPSTEAEALTSSLMGMFEKRRFKKFLSYVANFDENDSKTLECVDPKKTTMRD 170

  Fly   186 -------NEDSLEFRGRTFLEYLQAQRVTEKISSCVMQAIAMCGPSTSFEEGMQRTQRFLGSLGR 243
                   .:|.::|.|.....|    |..|.:....::.|             .|.:.:..||.|
 Frog   171 VYKKFDLGQDVIDFTGHALALY----RTDEYLDQPCLETI-------------NRIKLYSESLAR 218

  Fly   244 YGNTPFLFPMYGCGELPQCFCRLCAVYGGIYCLKRAVDDIALDSNSNEFLLSSAGKTLRAKNVVS 308
            ||.:|:|:|:||.|||||.|.||.|:|||.|.|.:.::::.:: |.....:.|.|:..|.|.::.
 Frog   219 YGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEELVME-NGKIVGVKSEGEVARCKQLIC 282

  Fly   309 APGYTPVSKGIELKPHISRGLFISSSPLGNEELNKGGGGVNLLRLL--DNEGGREA--FLIQLSH 369
            .|.|  ||..:.....:.|.:.|.|.|:      |.....|..:::  .|:..|::  ::..:|:
 Frog   283 DPSY--VSDRVTKVGQVIRVICILSHPI------KNTNDANSCQIIIPQNQVNRKSDIYVCMISY 339

  Fly   370 YTGACPEGLYIFHLTTPALSEDPASDLA-------------IFTSQLFDQ----SDAQIIFSSYF 417
            ......:|.||..::|...:.||..::.             :..|.::..    :|:||..|..:
 Frog   340 AHNVAAQGKYIAIVSTTVETNDPEREIKPVLELLEPIEQKFVSISDMYAPTDVGTDSQIFISRTY 404

  Fly   418 TIAAQSSKSPAAEHIYYTDPPTYELDYDAAIANARDIFGKMF-PDADFLPRAPDPEEIVVDGED 480
                              ||.|:   ::....:.:||:.:|. .:.||........:|.  |||
 Frog   405 ------------------DPTTH---FETTCNDIKDIYKRMMGSEFDFEEMKRKKSDIF--GED 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RepNP_477420.1 NADB_Rossmann 4..397 CDD:304358 106/417 (25%)
gdi2NP_001005676.1 GDI 1..436 CDD:307232 119/507 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.