DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rep and Gdi

Sequence 1:NP_477420.1 Gene:Rep FlyBaseID:FBgn0026378 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001245953.1 Gene:Gdi FlyBaseID:FBgn0004868 Length:443 Species:Drosophila melanogaster

Alignment Length:460 Identity:120/461 (26%)
Similarity:194/461 (42%) Gaps:108/461 (23%)


  Fly     7 EQFDLVVIGTGFTESCIAAAGSRIGKSVLHLDSNEYYGDVWSSFS-MDALCARLDQEVEPHSALR 70
            |::|.:|:|||..|..::...|..||.|||:|.|:|||...:|.: ::.|..|            
  Fly     3 EEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFQR------------ 55

  Fly    71 NARYTWHSMEKESETDAQSWNRDSVLAKSRRFSLDLCPRILYAAGELVQLLIKSNICRYAEFRAV 135
                  :.:|...|.          ..:.|.:::||.|:.|.|.|:||:|||.:.:.||.||:::
  Fly    56 ------YGLEPPGER----------FGRGRDWNVDLIPKFLMANGQLVKLLIHTGVTRYLEFKSI 104

  Fly   136 DHVCMRHNGEIVSVPCSRSDVFNTKTLTIVEKRLLMKFLTACNDYGED-----------KCNEDS 189
            :...:...|:|..||..:.:...:..:.:.|||....||....|:.||           |.|...
  Fly   105 EGSYVYKGGKIAKVPVDQKEALASDLMGMFEKRRFRNFLIYVQDFREDDPKTWKDFDPTKANMQG 169

  Fly   190 L-----------EFRGRTFL-----EYLQAQRVTEKISSCVMQAIAMCGPSTSFEEGMQRTQRFL 238
            |           :|.|....     |||....|..                      ::|.:.:.
  Fly   170 LYDKFGLDKNTQDFTGHALALFRDDEYLNEPAVNT----------------------IRRIKLYS 212

  Fly   239 GSLGRYGNTPFLFPMYGCGELPQCFCRLCAVYGGIYCLKRAVDDIALDSNSNEFLLSSAGKTLRA 303
            .||.|||.:|:|:||||.|||||.|.||.|:|||.|.|.:.:|:|.|........:.|..:..:.
  Fly   213 DSLARYGKSPYLYPMYGLGELPQGFARLSAIYGGTYMLDKPIDEIVLGEGGKVVGVRSGEEVAKC 277

  Fly   304 KNVVSAPGYTPVSKGIELKPHISRGLFISSSPLGNEELNKGGGGVNLLRLLDNEGGREA----FL 364
            |.|...|.|.|  :.:..:..:.|.:.|...|:.:   .|.|....:: :...:.||::    .|
  Fly   278 KQVYCDPSYVP--EKVRKRGKVIRCICILDHPVAS---TKDGLSTQII-IPQKQVGRKSDIYVSL 336

  Fly   365 IQLSHYTGACPEGLYIFHLTT------PALSEDPASDLAIFTSQLF-----------DQSDAQII 412
            :..:|...|  :|.::..::|      |.:...|..||....:|.|           |.|::||.
  Fly   337 VSSTHQVAA--KGWFVGMVSTTVETENPEVEIKPGLDLLEPIAQKFVTISDYLEPIDDGSESQIF 399

  Fly   413 FS-SY 416
            .| ||
  Fly   400 ISESY 404

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RepNP_477420.1 NADB_Rossmann 4..397 CDD:304358 111/428 (26%)
GdiNP_001245953.1 GDI 1..435 CDD:279353 120/461 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25454799
eggNOG 1 0.900 E1_COG5044
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11787
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.