DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rep and rep-1

Sequence 1:NP_477420.1 Gene:Rep FlyBaseID:FBgn0026378 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001022928.1 Gene:rep-1 WormBaseID:WBGene00022051 Length:510 Species:Caenorhabditis elegans

Alignment Length:514 Identity:155/515 (30%)
Similarity:251/515 (49%) Gaps:45/515 (9%)


  Fly     1 MLDDLPEQFDLVVIGTGFTESCIAAAGSRIGKSVLHLDSNEYYGDVWSSFSMDAL-------CAR 58
            |.:.|||..|:||:|||..|:.:|:|.:|.|.||||||.|||||..||||:|..:       ..:
 Worm     1 MDEKLPESVDVVVLGTGLPEAILASACARAGLSVLHLDRNEYYGGDWSSFTMSMVHEVTENQVKK 65

  Fly    59 LDQ-----------------EVEPHSALRNARYTWHSMEKESETDAQSWNRDSVLAKSRRFSLDL 106
            ||.                 |:.....:.|...||....|:.|...::...::  ::.||||:||
 Worm    66 LDSSEISKLSELLTENEQLIELGNREIVENIEMTWIPRGKDEEKPMKTQLEEA--SQMRRFSIDL 128

  Fly   107 CPRILYAAGELVQLLIKSNICRYAEFRAVD-HVCMRHNGE----IVSVPCSRSDVFNTKTLTIVE 166
            .|:||.:.|.:||.|..|.:..||||:.|: .:|.....|    :..||||:.::|.:..|:|:|
 Worm   129 VPKILLSKGAMVQTLCDSQVSHYAEFKLVNRQLCPTETPEAGITLNPVPCSKGEIFQSNALSILE 193

  Fly   167 KRLLMKFLTACNDYGEDKCNEDS---LEFRGRTFLEYLQAQRVTEKISSCVMQAIAMCGPSTSFE 228
            ||.||||:|.|..:......|..   .|...|.|.|:|:...|.:.:.|.::..|.:.....:..
 Worm   194 KRALMKFITFCTQWSTKDTEEGRKLLAEHADRPFSEFLEQMGVGKTLQSFIINTIGILQQRPTAM 258

  Fly   229 EGMQRTQRFLGSLGRYGNTPFLFPMYGCGELPQCFCRLCAVYGGIYCLKRAVDDIALDSNSNEFL 293
            .||..:.:|:.|:|.:|.:|||||:||||||.||||||.||:|.:|||.|.|..|.........:
 Worm   259 TGMLASCQFMDSVGHFGPSPFLFPLYGCGELSQCFCRLAAVFGSLYCLGRPVQAIVKKDGKITAV 323

  Fly   294 LSSAGKTLRAKNVVSAPGYTPVSKGIELKPHISRGLFISSSPLGNEELNKGGGGVNLLRLLD-NE 357
            ::: |..:..:.:|.:|.:.|.:........|.|.::.:...:...|..:    :.||.|.. ..
 Worm   324 IAN-GDRVNCRYIVMSPRFVPETVPASSTLKIERIVYATDKSIKEAEKEQ----LTLLNLASLRP 383

  Fly   358 GGREAFLIQLSHYTGACPEGLYIFHLTTPALSEDPASDLAIFTSQLFDQSDAQIIFSSYFTIAAQ 422
            ....:.|:::.......|:|.::.|.|.....|.....:|   .::|::::.:..:...||..:.
 Worm   384 DAAVSRLVEVGFEACTAPKGHFLVHATGTQEGETSVKTIA---EKIFEKNEVEPYWKMSFTANSM 445

  Fly   423 SSKSPAAEHIYYTDPPTYELDYDAAIANARDIFGKMFPDADFLPRAPDPEEIVVDGEDP 481
            ...:..||::....|....|.|.:.:...|.:|...:|:.||||||...||  .:.|:|
 Worm   446 KFDTAGAENVVVAPPVDANLHYASVVEECRQLFCTTWPELDFLPRAMKKEE--EEEEEP 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RepNP_477420.1 NADB_Rossmann 4..397 CDD:304358 132/426 (31%)
rep-1NP_001022928.1 NADB_Rossmann 1..>361 CDD:304358 123/363 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24590966
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 239 1.000 Inparanoid score I2090
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1017439at2759
OrthoFinder 1 1.000 FOG0003449
OrthoInspector 1 1.000 T474159
orthoMCL 1 0.900 OOG5_131589
Panther 1 1.100 LDO PTHR11787
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1844
TreeFam 00.000 Not matched by this tool.
1110.940

Return to query results.
Submit another query.