DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rep and Gdi1

Sequence 1:NP_477420.1 Gene:Rep FlyBaseID:FBgn0026378 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_034403.1 Gene:Gdi1 MGIID:99846 Length:447 Species:Mus musculus

Alignment Length:507 Identity:129/508 (25%)
Similarity:218/508 (43%) Gaps:123/508 (24%)


  Fly     5 LPEQFDLVVIGTGFTESCIAAAGSRIGKSVLHLDSNEYYGDVWSSFS-MDALCARLD-QEVEPHS 67
            :.|::|::|:|||.||..::...|..||.|||:|.|.|||...||.: ::.|..|.. .|..|.|
Mouse     1 MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQILEGPPES 65

  Fly    68 ALRNARYTWHSMEKESETDAQSWNRDSVLAKSRRFSLDLCPRILYAAGELVQLLIKSNICRYAEF 132
                                        :.:.|.:::||.|:.|.|.|:||::|:.:.:.||.:|
Mouse    66 ----------------------------MGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDF 102

  Fly   133 RAVDHVCMRHNGEIVSVPCSRSDVFNTKTLTIVEKRLLMKFL---------------------TA 176
            :.|:...:...|:|..||.:.::...:..:.:.|||...|||                     |:
Mouse   103 KVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQNTS 167

  Fly   177 CND-YGEDKCNEDSLEFRGRTFLEYLQAQRVTEKISSCVMQAIAMCGPSTSFEEGMQRTQRFLGS 240
            ..| |.:....:|.::|.|.....|    |..:.:....::.|             .|.:.:..|
Mouse   168 MRDVYRKFDLGQDVIDFTGHALALY----RTDDYLDQPCLETI-------------NRIKLYSES 215

  Fly   241 LGRYGNTPFLFPMYGCGELPQCFCRLCAVYGGIYCLKRAVDDIALDSNSNEFLLSSAGKTLRAKN 305
            |.|||.:|:|:|:||.|||||.|.||.|:|||.|.|.:.||||.:: |.....:.|.|:..|.|.
Mouse   216 LARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIME-NGKVVGVKSEGEVARCKQ 279

  Fly   306 VVSAPGYTPVSKGIELKPHISRGLFISSSPLGNEELNKGGGGVNLLRLL--DNEGGREA--FLIQ 366
            ::..|.|.|  ..::....:.|.:.|.|.|:      |.....|..:::  .|:..|::  ::..
Mouse   280 LICDPSYIP--DRVQKAGQVIRIICILSHPI------KNTNDANSCQIIIPQNQVNRKSDIYVCM 336

  Fly   367 LSHYTGACPEGLYIFHLTT------PALSEDPASDLA-------IFTSQLF----DQSDAQIIFS 414
            :|:......:|.||...:|      |....:||.:|.       :..|.|:    |.|::|:..|
Mouse   337 ISYAHNVAAQGKYIAIASTTVETAEPEKEVEPALELLEPIDQKFVAISDLYEPIDDGSESQVFCS 401

  Fly   415 -SYFTIAAQSSKSPAAEHIYYTDPPTYELDYDAAIANARDIFGKMFPDA-DF 464
             ||                   |..|:   ::....:.:||:.:|...| ||
Mouse   402 CSY-------------------DATTH---FETTCNDIKDIYKRMAGSAFDF 431

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RepNP_477420.1 NADB_Rossmann 4..397 CDD:304358 113/426 (27%)
Gdi1NP_034403.1 GDI 1..436 CDD:279353 129/508 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.