DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rep and Chml

Sequence 1:NP_477420.1 Gene:Rep FlyBaseID:FBgn0026378 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_067325.2 Gene:Chml MGIID:101913 Length:621 Species:Mus musculus

Alignment Length:627 Identity:179/628 (29%)
Similarity:296/628 (47%) Gaps:155/628 (25%)


  Fly     1 MLDDLPEQFDLVVIGTGFTESCIAAAGSRIGKSVLHLDSNEYYGDVWSSFSMDALCARLDQEVEP 65
            |.:.||.:||:|:||||..||.:|||.||.|:.|||:||..|||..|:|||...|.:.|....:.
Mouse     1 MAEKLPTEFDVVIIGTGLPESILAAACSRSGQRVLHVDSRSYYGGNWASFSFTGLQSWLKDYQQN 65

  Fly    66 HSALRNARYTWH----------SMEKESET-------------------DAQSWNRDS------- 94
            |.:......||.          |:.|:.||                   |.::..|.|       
Mouse    66 HDSEEGVTATWQDLIHETEEAISLRKKDETIQHTEVFCYASQDVEDSVQDTETLQRSSPLEASAT 130

  Fly    95 ----------------------------------------------------------------- 94
                                                                             
Mouse   131 PADSLDSASLPKERQSAYSTSYEVPSRHTEESDRELSLPSANVEDSLEKEKYCGDKTDMHTVSGE 195

  Fly    95 -------------------------VLAKSRRFSLDLCPRILYAAGELVQLLIKSNICRYAEFRA 134
                                     ::.:||||::||..:.||:.|.|:.||||||:.|||||:.
Mouse   196 DKGEHKLVVQDSIEQPKRNRITYSQMVKESRRFNIDLVSKPLYSQGSLIDLLIKSNVSRYAEFKN 260

  Fly   135 VDHVCMRHNGEIVSVPCSRSDVFNTKTLTIVEKRLLMKFLTACNDYGEDKCNEDSLEFRGRTFLE 199
            |..:.....|::..|||||:||||:|.|::||||:||||||.|.||  ::.:::..:|:..:|.:
Mouse   261 VTRILAFWEGKVEQVPCSRADVFNSKELSMVEKRMLMKFLTFCLDY--EQHSDEYQDFKQCSFSD 323

  Fly   200 YLQAQRVTEKISSCVMQAIAMCGPST-SFEEGMQRTQRFLGSLGRYGNTPFLFPMYGCGELPQCF 263
            ||:.:::|..:...::.:|||...|: :..:|:|.|:.||..|||:|||||:||:||.||:||||
Mouse   324 YLKTKKLTPNLQHFILHSIAMTSESSCTTLDGLQATKTFLQCLGRFGNTPFIFPLYGHGEIPQCF 388

  Fly   264 CRLCAVYGGIYCLKRAVDDIALDSNSN--EFLLSSAGKTLRAKNVVSAPGYTP--VSKGIELKPH 324
            ||:|||:||:|||:..|..:.:|.:|.  :.::.:.|:.:.|...:....|.|  ....::.| .
Mouse   389 CRMCAVFGGVYCLRHKVQCLVVDKDSGRCKGIIDAFGQRISANYFIVEDSYLPKETCSNVQYK-Q 452

  Fly   325 ISRGLFISSSPLGNEELNKGGGGVNLLRLLDNEGGREAF-LIQLSHYTGACPEGLYIFHLTTPAL 388
            |||.:.|:...:...:.::   .:::|.:...|.|..:. :::|...|..|.:..|:.|||..: 
Mouse   453 ISRAVLITDQSILKTDSDQ---QISILVVPPLEPGTTSVRVMELCSSTMTCMKDSYLVHLTCSS- 513

  Fly   389 SEDPASDLAIFTSQLF-DQSDAQ----------IIFSSYFTI-----AAQSSKSPAAEHIYYTDP 437
            |:....||.....||| .:::|:          ::::.||.:     .::||......::|....
Mouse   514 SKTAREDLEPVVKQLFIPEAEAEAGKDELRKPRLLWALYFNMRDSSGVSRSSYCGLPSNVYICSG 578

  Fly   438 PTYELDYDAAIANARDIFGKMFPDADFLPRAPDPEEIVVDGE 479
            |.:.|..:.|:..|..:|.::||..:|.|..|:||:|:.:.|
Mouse   579 PDWGLGSEHAVKQAETLFQEIFPSEEFCPPPPNPEDIIFEAE 620

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RepNP_477420.1 NADB_Rossmann 4..397 CDD:304358 155/525 (30%)
ChmlNP_067325.2 NADB_Rossmann 6..528 CDD:304358 155/529 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24600605
eggNOG 1 0.900 E1_COG5044
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 253 1.000 Inparanoid score I3173
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003449
OrthoInspector 1 1.000 T616398
orthoMCL 1 0.900 OOG5_131589
Panther 1 1.100 O PTHR11787
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1844
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.