DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rep and Chm

Sequence 1:NP_477420.1 Gene:Rep FlyBaseID:FBgn0026378 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_061288.2 Gene:Chm MGIID:892979 Length:662 Species:Mus musculus

Alignment Length:636 Identity:196/637 (31%)
Similarity:295/637 (46%) Gaps:165/637 (26%)


  Fly     1 MLDDLPEQFDLVVIGTGFTESCIAAAGSRIGKSVLHLDSNEYYGDVWSSFSMDALCARLDQEVEP 65
            |.|:||..||::|||||..||.||||.||.|:.|||:||..|||..|:|||...|.:.| :|.:.
Mouse     1 MADNLPSDFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLSWL-KEYQE 64

  Fly    66 HSALRNARYTWHSM--------------------------------------------------- 79
            :|.:......|...                                                   
Mouse    65 NSDVVTENSMWQEQILENEEAILLSSKDKTIQHVEVFCYASQDLHKDVEEAGALQKNPASVMSAQ 129

  Fly    80 -------------------------------------------------------------EKES 83
                                                                         |||:
Mouse   130 ATEAAEAAEAAEAAEATEAAEAACLPTAEESLSTRSCELPAEQSQCTGPESSPQVNDAEVGEKET 194

  Fly    84 ETDAQSWNRDS-----------------------VLAKSRRFSLDLCPRILYAAGELVQLLIKSN 125
            ::||:|....|                       ::.:.|||::||..::||:.|.|:.||||||
Mouse   195 QSDAKSSTEQSSEILPKVQDNTETPKRNVITYSQIIKEGRRFNIDLVSKLLYSRGLLIDLLIKSN 259

  Fly   126 ICRYAEFRAVDHVCMRHNGEIVSVPCSRSDVFNTKTLTIVEKRLLMKFLTACNDYGEDKCNEDSL 190
            :.|||||:.:..:.....|.:..|||||:||||:|.||:||||:||||||.|.:| ||..:|.. 
Mouse   260 VSRYAEFKNITRILAFREGTVEQVPCSRADVFNSKQLTMVEKRMLMKFLTFCVEY-EDHPDEYK- 322

  Fly   191 EFRGRTFLEYLQAQRVTEKISSCVMQAIAMCGPSTSFE-EGMQRTQRFLGSLGRYGNTPFLFPMY 254
            .:...||.|||:.|::|..:...|:.:|||...:||.. :|::.|::||..||||||||||||:|
Mouse   323 AYEETTFSEYLKTQKLTPNLQYFVLHSIAMTSETTSSTVDGLKATKKFLQCLGRYGNTPFLFPLY 387

  Fly   255 GCGELPQCFCRLCAVYGGIYCLKRAVDDIALDSNSN--EFLLSSAGKTLRAKNVVSAPGYTP--V 315
            |.|||||||||:|||:||||||:.:|..:.:|..|.  :.::...|:.:.:|:.|....|..  .
Mouse   388 GQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDKESRKCKAIVDQFGQRIISKHFVIEDSYLSENT 452

  Fly   316 SKGIELKPHISRGLFISSSPLGNEELNKGGGGVNLLRLLDNEGGREAF-LIQLSHYTGACPEGLY 379
            ..|::.: .|||.:.|:...:...:.::   .|::|.:...|.|..|. :|:|...|..|.:|.|
Mouse   453 CSGVQYR-QISRAVLITDGSVLKPDSDQ---QVSILTVPAEESGSFAVRVIELCSSTMTCMKGTY 513

  Fly   380 IFHLTTPALSEDPASDLAIFTSQLF----------DQSD-AQIIFSSYFTIAAQSSKS-----PA 428
            :.|||..: |:....||.....:||          :|.: .:|:::.||.:...|..|     ..
Mouse   514 LVHLTCMS-SKTAREDLERVVQKLFTPYTEIEAENEQVEKPRILWALYFNMRDSSDISRDCYNDL 577

  Fly   429 AEHIYYTDPPTYELDYDAAIANARDIFGKMFPDADFLPRAPDPEEIVVDGE 479
            ..::|....|...|..|.|:..|..:|.|:.|:.||.|..|:||:|::||:
Mouse   578 PSNVYVCSGPDCNLGNDNAVQQAETVFQKICPNEDFCPAPPNPEDIILDGD 628

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RepNP_477420.1 NADB_Rossmann 4..397 CDD:304358 168/534 (31%)
ChmNP_061288.2 NAD_binding_8 13..>54 CDD:290186 26/41 (63%)
NADB_Rossmann 234..542 CDD:304358 128/315 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C24601478
eggNOG 1 0.900 E1_COG5044
Hieranoid 1 1.000
Homologene 1 1.000 H334
Inparanoid 1 1.050 253 1.000 Inparanoid score I3173
Isobase 1 0.950 0.811278 Normalized mean entropy S3491
OMA 1 1.010
OrthoDB 1 1.010 D1017439at2759
OrthoFinder 1 1.000 FOG0003449
OrthoInspector 1 1.000 T616398
orthoMCL 1 0.900 OOG5_131589
Panther 1 1.100 LDO PTHR11787
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1844
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.