DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TBCB and DCTN1-p150

Sequence 1:NP_611425.1 Gene:TBCB FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_524061.1 Gene:DCTN1-p150 FlyBaseID:FBgn0001108 Length:1265 Species:Drosophila melanogaster

Alignment Length:76 Identity:29/77 (38%)
Similarity:39/77 (51%) Gaps:3/77 (4%)


  Fly   160 LGGRCEVTVPGNPTRRGTIRYNGPLEGKSGHFIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGFVS 224
            :|.|.|:|   .....||:.|.|......|.::||..|||.|||:||..|:.||.|..|.|.||.
  Fly     8 VGARVELT---GKDLLGTVAYVGMTSFAVGKWVGVVLDEPKGKNSGSIKGQQYFQCDENCGMFVR 69

  Fly   225 PLSVTVGDFPP 235
            |..:.:.:..|
  Fly    70 PTQLRLLEAAP 80

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TBCBNP_611425.1 Alp11_N 12..95 CDD:176384
CAP_GLY 161..225 CDD:279625 27/64 (42%)
DCTN1-p150NP_524061.1 CAP_GLY 8..74 CDD:214997 28/69 (41%)
Dynactin 553..834 CDD:289240
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1550378at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18916
RoundUp 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.