DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CalpA and si:dkeyp-50d11.2

Sequence 1:NP_001286613.1 Gene:CalpA FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_009293787.1 Gene:si:dkeyp-50d11.2 ZFINID:ZDB-GENE-091113-22 Length:704 Species:Danio rerio

Alignment Length:770 Identity:320/771 (42%)
Similarity:443/771 (57%) Gaps:114/771 (15%)


  Fly    88 QDYETILNSCLASGSLFEDPLFPASNESLQF-----SRRPDRHIEWLRPHEIAENPQFFVEGYSR 147
            ||:|::...||.||.||||.:|||...||.|     :....|.:.|:||.|...:|.|.|:|.:|
Zfish    35 QDFESLRTRCLQSGHLFEDDIFPAQQSSLGFKELGPNSSKTRGVRWMRPTEFCSDPHFIVDGATR 99

  Fly   148 FDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVIIDDRLP 212
            .|:.||.|||||||||.|.||....|..||:|..|||.:.|||||||:|||:|.||||:||||||
Zfish   100 TDICQGALGDCWLLAAIACLTLNEPLLRRVVPHGQSFHQQYAGIFHFQFWQFGDWVDVVIDDRLP 164

  Fly   213 TYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDLKEAPGNL 277
            ..:|:|:::||.|.:||||||:|||||||:|.||||.||||.|..|||||||:|.|:||.||.||
Zfish   165 VRDGKLLFVHSAEGSEFWSALVEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYELKNAPPNL 229

  Fly   278 FTILQKAAERNSMMGCSIEPDPNVT-----EAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPM 337
            |:|:.:|.||.|:|||||:    :|     ||.|.:.|::|||||||.|..::.    |:.:..:
Zfish   230 FSIITRAVERGSLMGCSID----ITSFFDMEAITFKKLVKGHAYSITGVDEVEY----RRSQTKL 286

  Fly   338 IRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLS 402
            :|:||||| |.||.|||||.|.|||.|....::.:. ....||||||:|.||...|.|:|||||:
Zfish   287 LRIRNPWG-EVEWTGPWSDESKEWREIDASVRSRLH-NCQEDGEFWMAFSDFKREFSRLEICNLT 349

  Fly   403 PDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTV 467
            .|:|    |:...:||..|:|.|||..|.|||||||:..|||.|||:.|.|.:||.:::|| ||.
Zfish   350 ADAL----QSREVKKWNSSLYPGEWRRGSTAGGCRNYPATFWINPQFKIVLKEPDTDNQEG-CTF 409

  Fly   468 IVALMQKNRRSKRNMGMECLTIGFAIYSLNDRELENRPQGL--NFFRYKSSVGRSPHFINTREVC 530
            :|||||||||..|..|.:..|||||||.:....|......|  :||...:|..||..|||.|||.
Zfish   410 LVALMQKNRRQLRREGKDMETIGFAIYEVPKEYLGRVGVHLKRDFFLKHTSSARSELFINLREVS 474

  Fly   531 ARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEENDDHVGYGGKADTITPGFPTPKPIDP 595
            :||.||.|.|:||||||:|.:||:|::|||||...:.:|.||.:    .||  .|..|..:..|.
Zfish   475 SRFSLPAGEYIIVPSTFEPQKEGDFVLRVFSEKATDSQELDDEI----SAD--VPEEPVLQESDI 533

  Fly   596 QKEGLRRLFDSIAGKDMEVDWMELKRILDH--SMRDDLPKPVVFNRFSNNMAFETQAAGPGDDGA 658
            . ||.:.||..:||.:||::..:|:.||:.  |...|:                           
Zfish   534 D-EGFKALFAKLAGPEMEINVAKLEMILNRVVSKHKDI--------------------------- 570

  Fly   659 GACGLLSLICGPFLKGTPFEEQLGMNDQSNKRLIGDNPADGGPVTANAIVDETHGFSKDVCRSMV 723
                                                               :|.||.|:.||.|:
Zfish   571 ---------------------------------------------------KTDGFGKETCRGMI 584

  Fly   724 AMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVL 788
            .::|...:||||..:|..|..:..::.|:|:.:|::.:|.:|.:::|.||.|||:.|.|.:..::
Zfish   585 NLMDTTGTGKLGLTDFHVLWEKFKRYLAVFREFDIDKSGTMSSYEMRLALESAGFKLTNNLFQLI 649

  Fly   789 GHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEWIERTIYS 843
            ..||...|..:.||:|:.|.::::|....||..|.:::...:|:..:||..|:::
Zfish   650 ILRYAKSDLNVDFDNFVACLIRLETMFKTFKTLDADEDGLVSFSFAQWITLTMFT 704

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042 163/306 (53%)
Calpain_III 418..565 CDD:279416 80/149 (54%)
EFh 719..765 CDD:238008 14/46 (30%)
si:dkeyp-50d11.2XP_009293787.1 EFh 612..667 CDD:238008 19/55 (35%)
EF-hand_7 613..698 CDD:290234 25/85 (29%)
Peptidase_C2 51..347 CDD:279042 163/306 (53%)
Calpain_III 361..507 CDD:279416 80/147 (54%)
EF1B 500..563 CDD:294128 24/70 (34%)
EFh 580..630 CDD:298682 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 656 1.000 Inparanoid score I737
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D704215at2759
OrthoFinder 1 1.000 FOG0000031
OrthoInspector 1 1.000 T128690
orthoMCL 1 0.900 OOG5_127139
Panther 1 1.100 O PTHR10183
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.