DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and Ctsll3

DIOPT Version :10

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_081620.2 Gene:Ctsll3 / 70202 MGIID:1917452 Length:331 Species:Mus musculus


Alignment Length:65 Identity:20/65 - (30%)
Similarity:35/65 - (53%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQ 70
            |..|.|:|:|..|.|...::..:|.::..:|..|:.||..:.||:..:.:.:|...|||..||.:
Mouse    26 DAVWEEWKTKHKKTYNMNDEGQKRAVWENNKKMIDLHNEDYLKGKHGFSLEMNAFGDLTNTEFRE 90

  Fly    71  70
            Mouse    91  90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 17/58 (29%)
Ctsll3NP_081620.2 Inhibitor_I29 29..87 CDD:214853 17/57 (30%)
Peptidase_C1 115..330 CDD:425470
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.