powered by:
Protein Alignment cer and Ctsll3
DIOPT Version :9
| Sequence 1: | NP_611420.1 |
Gene: | cer / 37229 |
FlyBaseID: | FBgn0034443 |
Length: | 79 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_081620.2 |
Gene: | Ctsll3 / 70202 |
MGIID: | 1917452 |
Length: | 331 |
Species: | Mus musculus |
| Alignment Length: | 65 |
Identity: | 20/65 - (30%) |
| Similarity: | 35/65 - (53%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 DEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQ 70
|..|.|:|:|..|.|...::..:|.::..:|..|:.||..:.||:..:.:.:|...|||..||.:
Mouse 26 DAVWEEWKTKHKKTYNMNDEGQKRAVWENNKKMIDLHNEDYLKGKHGFSLEMNAFGDLTNTEFRE 90
Fly 71 70
Mouse 91 90
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
1 |
1.000 |
63 |
1.000 |
Domainoid score |
I10182 |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.