DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and zgc:174153

DIOPT Version :10

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001104662.1 Gene:zgc:174153 / 567623 ZFINID:ZDB-GENE-080215-7 Length:336 Species:Danio rerio


Alignment Length:75 Identity:30/75 - (40%)
Similarity:46/75 - (61%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQ 70
            |:.|..:||:..|:|..:.::.||.|:.|:..:||:||.::..|..|:|||:|...|:|.|||.|
Zfish    25 DDHWNSWKSQHGKSYHEDVEVGRRMIWEENLRKIEQHNFEYSYGNHTFKMGMNQFGDMTNEEFRQ 89

  Fly    71 RC-GKKVPPN 79
            .. |.|..||
Zfish    90 AMNGYKHDPN 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 22/58 (38%)
zgc:174153NP_001104662.1 Inhibitor_I29 28..86 CDD:214853 21/57 (37%)
Peptidase_C1 115..335 CDD:425470
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.