DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and ctso

DIOPT Version :10

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_695717.5 Gene:ctso / 567333 ZFINID:ZDB-GENE-080724-8 Length:334 Species:Danio rerio


Alignment Length:69 Identity:14/69 - (20%)
Similarity:33/69 - (47%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VSDEEWVEYKSKFDKNYEAEEDLMRRRI-YAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEE 67
            :::.|.:::...|.:  :...:|.:|.| |..|..|....|....|...:.:.|:|..:.|:.::
Zfish    30 LTEGERLQHSDTFQQ--DVNNELYQRWINYQSSLQRQAFLNSALGKSNQSAQYGVNQFSYLSQKQ 92

  Fly    68 FAQR 71
            |.::
Zfish    93 FKEQ 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 12/59 (20%)
ctsoXP_695717.5 None

Return to query results.
Submit another query.