DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and LOC5667926

DIOPT Version :10

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_001689282.2 Gene:LOC5667926 / 5667926 VectorBaseID:AGAMI1_000181 Length:343 Species:Anopheles gambiae


Alignment Length:63 Identity:23/63 - (36%)
Similarity:43/63 - (68%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EEWVEYKSKFDKNYEAE-EDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEF 68
            |||..:|.:..|.|::| |:.:|.:||.::|.:|.:||::::.|:..:::.:|..|||..|||
Mosquito    25 EEWTAFKLQHRKKYDSETEERIRMKIYVQNKHKIAKHNQRYDLGQEKFRLRVNKYADLLHEEF 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 19/59 (32%)
LOC5667926XP_001689282.2 None

Return to query results.
Submit another query.